Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PYA4

Protein Details
Accession A8PYA4    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-51RMKTDNKIQYNKNRRHWRRTKLSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14.333, mito 14, nucl 12.5, cyto_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgl:MGL_1623  -  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MPSHKTFRTKVKLAKAARQNRSIPNWFRMKTDNKIQYNKNRRHWRRTKLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.73
4 0.7
5 0.69
6 0.63
7 0.6
8 0.62
9 0.61
10 0.54
11 0.51
12 0.52
13 0.46
14 0.43
15 0.44
16 0.43
17 0.41
18 0.47
19 0.5
20 0.5
21 0.56
22 0.61
23 0.66
24 0.71
25 0.75
26 0.76
27 0.78
28 0.81
29 0.85
30 0.88
31 0.88