Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HB95

Protein Details
Accession Q2HB95    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40ASSARIKKNNKSQQIKFKVRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIGDIKKFIEICRRGDASSARIKKNNKSQQIKFKVRCQRFLYTLVLKDSEKAEKLKQSLPPNLQIKDVPKRNKQKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.39
4 0.35
5 0.38
6 0.38
7 0.34
8 0.4
9 0.42
10 0.39
11 0.44
12 0.47
13 0.51
14 0.6
15 0.64
16 0.64
17 0.66
18 0.69
19 0.74
20 0.8
21 0.82
22 0.75
23 0.75
24 0.75
25 0.69
26 0.7
27 0.63
28 0.58
29 0.5
30 0.5
31 0.46
32 0.39
33 0.38
34 0.32
35 0.29
36 0.24
37 0.23
38 0.22
39 0.2
40 0.19
41 0.19
42 0.21
43 0.25
44 0.28
45 0.32
46 0.37
47 0.41
48 0.47
49 0.49
50 0.54
51 0.55
52 0.53
53 0.5
54 0.47
55 0.47
56 0.49
57 0.54
58 0.54
59 0.58
60 0.68