Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q6D0

Protein Details
Accession A8Q6D0   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-48TVDEALKKKEKKEKKEKKERKEKKEKKEEQHDAVGEBasic
NLS Segment(s)
PositionSequence
19-39KKKEKKEKKEKKERKEKKEKK
Subcellular Location(s) nucl 24.5, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
KEGG mgl:MGL_2926  -  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MASEEVKQKKSVTVDEALKKKEKKEKKEKKERKEKKEKKEEQHDAVGEDSVGDVSMADVSTTETDVEVDPSTLSAIACNLVILAGDISPVDILSHIPVLCEDTGNPYVFVASKDQLGNASSTKRPTSCVMIVPGGGKKAVEKGETKVKEDYQEDYSFLHKEASRLVQQVLMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.55
4 0.55
5 0.58
6 0.57
7 0.6
8 0.63
9 0.65
10 0.67
11 0.73
12 0.79
13 0.82
14 0.9
15 0.93
16 0.94
17 0.96
18 0.95
19 0.95
20 0.95
21 0.94
22 0.94
23 0.95
24 0.93
25 0.92
26 0.93
27 0.9
28 0.83
29 0.8
30 0.7
31 0.6
32 0.5
33 0.4
34 0.28
35 0.19
36 0.14
37 0.07
38 0.06
39 0.04
40 0.03
41 0.03
42 0.04
43 0.03
44 0.03
45 0.03
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.03
77 0.02
78 0.03
79 0.03
80 0.03
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.07
87 0.07
88 0.07
89 0.1
90 0.12
91 0.13
92 0.13
93 0.11
94 0.11
95 0.12
96 0.13
97 0.11
98 0.09
99 0.11
100 0.11
101 0.12
102 0.12
103 0.12
104 0.13
105 0.12
106 0.15
107 0.15
108 0.18
109 0.2
110 0.2
111 0.22
112 0.23
113 0.28
114 0.27
115 0.28
116 0.28
117 0.26
118 0.26
119 0.26
120 0.24
121 0.19
122 0.17
123 0.14
124 0.12
125 0.16
126 0.18
127 0.19
128 0.2
129 0.24
130 0.34
131 0.36
132 0.39
133 0.39
134 0.38
135 0.41
136 0.41
137 0.4
138 0.35
139 0.35
140 0.32
141 0.29
142 0.29
143 0.24
144 0.23
145 0.24
146 0.2
147 0.19
148 0.24
149 0.28
150 0.31
151 0.32
152 0.32