Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q4K2

Protein Details
Accession A8Q4K2    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-140MRSNLRSESNRKKRQRRRELFKEKKRAQDPBasic
168-189APPTLTARSKERRRKTEDAAIQHydrophilic
NLS Segment(s)
PositionSequence
36-56PRRAIELLRGPPPPSKKLRIR
120-136NRKKRQRRRELFKEKKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
KEGG mgl:MGL_2553  -  
Amino Acid Sequences MPRKRAKQSARLAQRSALGYDLPPQAKKRGEWGDTPRRAIELLRGPPPPSKKLRIRKDDLNENAPTAGAKTPTTGKTLSIPMDMHIRHGERLKDFNERVEQAFAHDINQTMRSNLRSESNRKKRQRRRELFKEKKRAQDPIAAQKAEEDELDFARAPLSRSLHDVVQAPPTLTARSKERRRKTEDAAIQLPERAEPSAARQRILDEERERVIQQYRAQKHRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.56
3 0.47
4 0.38
5 0.28
6 0.21
7 0.25
8 0.29
9 0.27
10 0.28
11 0.3
12 0.35
13 0.38
14 0.39
15 0.42
16 0.44
17 0.45
18 0.49
19 0.56
20 0.6
21 0.62
22 0.64
23 0.55
24 0.47
25 0.45
26 0.37
27 0.35
28 0.32
29 0.32
30 0.34
31 0.35
32 0.36
33 0.41
34 0.46
35 0.45
36 0.43
37 0.48
38 0.53
39 0.61
40 0.7
41 0.73
42 0.75
43 0.77
44 0.78
45 0.79
46 0.74
47 0.69
48 0.6
49 0.51
50 0.44
51 0.35
52 0.27
53 0.18
54 0.15
55 0.1
56 0.1
57 0.1
58 0.14
59 0.16
60 0.19
61 0.17
62 0.17
63 0.18
64 0.21
65 0.21
66 0.19
67 0.17
68 0.16
69 0.21
70 0.2
71 0.19
72 0.2
73 0.19
74 0.19
75 0.23
76 0.24
77 0.21
78 0.25
79 0.25
80 0.29
81 0.28
82 0.29
83 0.3
84 0.28
85 0.27
86 0.25
87 0.23
88 0.17
89 0.18
90 0.15
91 0.12
92 0.11
93 0.11
94 0.1
95 0.14
96 0.12
97 0.11
98 0.12
99 0.12
100 0.13
101 0.13
102 0.18
103 0.19
104 0.27
105 0.38
106 0.48
107 0.57
108 0.65
109 0.75
110 0.8
111 0.87
112 0.9
113 0.9
114 0.89
115 0.9
116 0.93
117 0.93
118 0.93
119 0.92
120 0.87
121 0.85
122 0.79
123 0.73
124 0.63
125 0.6
126 0.56
127 0.55
128 0.55
129 0.46
130 0.42
131 0.37
132 0.36
133 0.28
134 0.23
135 0.13
136 0.09
137 0.09
138 0.11
139 0.1
140 0.08
141 0.09
142 0.1
143 0.1
144 0.14
145 0.15
146 0.15
147 0.19
148 0.21
149 0.2
150 0.21
151 0.22
152 0.19
153 0.21
154 0.21
155 0.18
156 0.18
157 0.18
158 0.18
159 0.18
160 0.2
161 0.24
162 0.33
163 0.43
164 0.52
165 0.62
166 0.69
167 0.76
168 0.8
169 0.8
170 0.8
171 0.77
172 0.74
173 0.68
174 0.61
175 0.53
176 0.47
177 0.4
178 0.3
179 0.24
180 0.17
181 0.15
182 0.12
183 0.2
184 0.28
185 0.29
186 0.29
187 0.28
188 0.3
189 0.37
190 0.4
191 0.4
192 0.34
193 0.38
194 0.39
195 0.42
196 0.4
197 0.36
198 0.37
199 0.35
200 0.38
201 0.44
202 0.5