Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q3G0

Protein Details
Accession A8Q3G0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
223-247AVAAAMKKRKGKKRAIDNVDKKATAHydrophilic
NLS Segment(s)
PositionSequence
228-237MKKRKGKKRA
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024974  Sde2_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG mgl:MGL_2388  -  
Pfam View protein in Pfam  
PF13019  Sde2_N_Ubi  
Amino Acid Sequences MCEPYDRTVKISLARSTSCATLYDRITAVLGRNSDIVRLTSRGGHSICPSYTLNELAGVYPCVDLELRVRHLGGKGGFGNMLRAQGGRMSARGKHESQDSCRDLQGRRLGSIKEAQLLAEYIAKEPDRKAALDEAQKRKYAKLERMLGREPKSMDDFQEAAEKLEEAGDSLDASHESAPSSSASASASVNETRTASAPKRKERLDDHEYVEQSREIVDNVRGAVAAAMKKRKGKKRAIDNVDKKATAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.37
4 0.36
5 0.3
6 0.26
7 0.25
8 0.25
9 0.25
10 0.25
11 0.23
12 0.22
13 0.22
14 0.21
15 0.21
16 0.19
17 0.19
18 0.17
19 0.19
20 0.19
21 0.19
22 0.19
23 0.18
24 0.16
25 0.17
26 0.18
27 0.2
28 0.21
29 0.24
30 0.24
31 0.25
32 0.25
33 0.28
34 0.27
35 0.26
36 0.25
37 0.22
38 0.23
39 0.22
40 0.19
41 0.15
42 0.16
43 0.13
44 0.13
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.08
51 0.07
52 0.11
53 0.15
54 0.16
55 0.17
56 0.18
57 0.19
58 0.19
59 0.23
60 0.2
61 0.19
62 0.17
63 0.17
64 0.17
65 0.16
66 0.18
67 0.14
68 0.14
69 0.11
70 0.1
71 0.1
72 0.1
73 0.12
74 0.1
75 0.11
76 0.13
77 0.15
78 0.2
79 0.24
80 0.24
81 0.24
82 0.3
83 0.32
84 0.34
85 0.4
86 0.38
87 0.35
88 0.36
89 0.37
90 0.31
91 0.33
92 0.35
93 0.27
94 0.26
95 0.27
96 0.26
97 0.25
98 0.28
99 0.22
100 0.18
101 0.17
102 0.15
103 0.13
104 0.13
105 0.11
106 0.09
107 0.09
108 0.07
109 0.09
110 0.09
111 0.1
112 0.1
113 0.13
114 0.12
115 0.12
116 0.13
117 0.15
118 0.19
119 0.25
120 0.33
121 0.37
122 0.38
123 0.41
124 0.41
125 0.39
126 0.42
127 0.42
128 0.41
129 0.42
130 0.48
131 0.5
132 0.54
133 0.57
134 0.56
135 0.53
136 0.49
137 0.41
138 0.35
139 0.35
140 0.3
141 0.27
142 0.24
143 0.21
144 0.19
145 0.24
146 0.21
147 0.18
148 0.17
149 0.15
150 0.12
151 0.12
152 0.11
153 0.06
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.08
168 0.07
169 0.07
170 0.08
171 0.08
172 0.09
173 0.09
174 0.11
175 0.11
176 0.12
177 0.12
178 0.13
179 0.12
180 0.14
181 0.19
182 0.22
183 0.3
184 0.38
185 0.46
186 0.53
187 0.54
188 0.6
189 0.62
190 0.65
191 0.64
192 0.61
193 0.57
194 0.57
195 0.55
196 0.49
197 0.43
198 0.35
199 0.27
200 0.22
201 0.18
202 0.12
203 0.14
204 0.14
205 0.14
206 0.14
207 0.14
208 0.13
209 0.13
210 0.13
211 0.14
212 0.16
213 0.21
214 0.27
215 0.32
216 0.4
217 0.49
218 0.58
219 0.64
220 0.71
221 0.74
222 0.79
223 0.85
224 0.88
225 0.89
226 0.89
227 0.89
228 0.85