Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PUR6

Protein Details
Accession A8PUR6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKKSTRTPGAGRKKMPPBasic
NLS Segment(s)
PositionSequence
3-17KRKKSTRTPGAGRKK
Subcellular Location(s) mito 16.5, cyto_mito 12.333, mito_nucl 10.666, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG mgl:MGL_0754  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSTRTPGAGRKKMPPLDTVFTCLFCHHERAVSCKIDEKARIGYLSCKICGQNFSADTDTLSQPIDVYSQWIDACEDVADNDAAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.76
4 0.72
5 0.63
6 0.58
7 0.53
8 0.51
9 0.47
10 0.45
11 0.36
12 0.32
13 0.31
14 0.26
15 0.24
16 0.19
17 0.22
18 0.17
19 0.2
20 0.19
21 0.24
22 0.29
23 0.27
24 0.26
25 0.27
26 0.28
27 0.27
28 0.28
29 0.24
30 0.22
31 0.21
32 0.21
33 0.17
34 0.18
35 0.2
36 0.21
37 0.19
38 0.18
39 0.17
40 0.18
41 0.19
42 0.18
43 0.18
44 0.17
45 0.2
46 0.2
47 0.19
48 0.19
49 0.2
50 0.19
51 0.14
52 0.14
53 0.1
54 0.09
55 0.09
56 0.1
57 0.07
58 0.09
59 0.09
60 0.11
61 0.11
62 0.11
63 0.12
64 0.11
65 0.12
66 0.09
67 0.09
68 0.07
69 0.1
70 0.09