Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q4M2

Protein Details
Accession A8Q4M2   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28PATTIPIVKKRTKRFARHQSDRFKRVAHydrophilic
NLS Segment(s)
PositionSequence
10-26KKRTKRFARHQSDRFKR
Subcellular Location(s) mito_nucl 12.5, mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgl:MGL_2573  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPATTIPIVKKRTKRFARHQSDRFKRVAPNWRKPTGIDNCVRRRFKGTIAMPKIGYGSNKKTRHIMPNGFRRFVVANPSDMDLLLMHNNTFAAEIAHNVSSKKRIQILEKYVLSDVLNTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.86
4 0.89
5 0.9
6 0.89
7 0.9
8 0.89
9 0.85
10 0.76
11 0.69
12 0.64
13 0.62
14 0.63
15 0.62
16 0.64
17 0.66
18 0.67
19 0.64
20 0.59
21 0.6
22 0.57
23 0.55
24 0.5
25 0.51
26 0.57
27 0.65
28 0.65
29 0.57
30 0.55
31 0.49
32 0.46
33 0.47
34 0.44
35 0.45
36 0.48
37 0.48
38 0.43
39 0.41
40 0.38
41 0.29
42 0.25
43 0.19
44 0.23
45 0.3
46 0.32
47 0.33
48 0.36
49 0.39
50 0.44
51 0.47
52 0.48
53 0.46
54 0.55
55 0.58
56 0.55
57 0.51
58 0.45
59 0.39
60 0.32
61 0.31
62 0.21
63 0.19
64 0.19
65 0.2
66 0.18
67 0.17
68 0.16
69 0.09
70 0.09
71 0.09
72 0.09
73 0.07
74 0.08
75 0.08
76 0.07
77 0.08
78 0.06
79 0.06
80 0.06
81 0.08
82 0.1
83 0.11
84 0.12
85 0.12
86 0.15
87 0.19
88 0.22
89 0.26
90 0.3
91 0.33
92 0.4
93 0.48
94 0.54
95 0.58
96 0.56
97 0.53
98 0.48
99 0.45
100 0.37