Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8QDJ9

Protein Details
Accession A8QDJ9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-64EGRRNRAPPRLRFNRENRKNPAAHydrophilic
NLS Segment(s)
PositionSequence
44-60RRNRAPPRLRFNRENRK
Subcellular Location(s) mito 14, nucl 7, cyto_nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgl:MGL_4215  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVDLSQRLLMETEYVLPKLYIKLAYCVSCAIHSKVVRVRSVEGRRNRAPPRLRFNRENRKNPAAQLAAGGARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.14
5 0.14
6 0.15
7 0.14
8 0.13
9 0.16
10 0.19
11 0.19
12 0.19
13 0.19
14 0.17
15 0.16
16 0.18
17 0.16
18 0.19
19 0.18
20 0.21
21 0.24
22 0.26
23 0.26
24 0.24
25 0.25
26 0.29
27 0.36
28 0.41
29 0.43
30 0.48
31 0.51
32 0.58
33 0.59
34 0.59
35 0.6
36 0.61
37 0.65
38 0.68
39 0.72
40 0.73
41 0.79
42 0.82
43 0.84
44 0.84
45 0.82
46 0.79
47 0.75
48 0.68
49 0.66
50 0.57
51 0.47
52 0.39
53 0.34