Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q377

Protein Details
Accession A8Q377    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-38IKFPDRRAPKPEHKPQPHPDAPBasic
NLS Segment(s)
PositionSequence
13-29HKPMIKFPDRRAPKPEH
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020373  Kgd4/YMR-31  
Gene Ontology GO:0009353  C:mitochondrial oxoglutarate dehydrogenase complex  
GO:0006103  P:2-oxoglutarate metabolic process  
KEGG mgl:MGL_2329  -  
Pfam View protein in Pfam  
PF10937  S36_mt  
Amino Acid Sequences MLRPSLVRAARAHKPMIKFPDRRAPKPEHKPQPHPDAPEDIANNFEQFRQVLESGPHYDPSKLKPFSLDSGKSASGQTGSRDAVTTVFDLPRRFWDTPALRMSPAEMDAIQSGGASMMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.55
4 0.58
5 0.55
6 0.57
7 0.62
8 0.65
9 0.65
10 0.64
11 0.64
12 0.65
13 0.71
14 0.76
15 0.76
16 0.77
17 0.82
18 0.82
19 0.83
20 0.78
21 0.71
22 0.63
23 0.57
24 0.5
25 0.45
26 0.38
27 0.28
28 0.25
29 0.21
30 0.19
31 0.14
32 0.13
33 0.09
34 0.08
35 0.09
36 0.09
37 0.09
38 0.1
39 0.1
40 0.13
41 0.16
42 0.16
43 0.17
44 0.16
45 0.17
46 0.17
47 0.2
48 0.27
49 0.23
50 0.23
51 0.23
52 0.25
53 0.28
54 0.33
55 0.3
56 0.23
57 0.25
58 0.26
59 0.24
60 0.22
61 0.18
62 0.14
63 0.13
64 0.14
65 0.13
66 0.13
67 0.13
68 0.13
69 0.13
70 0.12
71 0.12
72 0.12
73 0.1
74 0.12
75 0.15
76 0.15
77 0.16
78 0.22
79 0.28
80 0.27
81 0.27
82 0.34
83 0.36
84 0.41
85 0.46
86 0.41
87 0.35
88 0.35
89 0.35
90 0.27
91 0.24
92 0.19
93 0.13
94 0.13
95 0.13
96 0.13
97 0.11
98 0.09
99 0.08