Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q2I0

Protein Details
Accession A8Q2I0    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAARSTHKRKRSAKRADNERGKPGGBasic
413-440DGYNAAQRARKVRRKSHTRRGESEHGLFHydrophilic
NLS Segment(s)
PositionSequence
7-24HKRKRSAKRADNERGKPG
420-432RARKVRRKSHTRR
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013893  RNase_P_Rpp40  
Gene Ontology GO:0030677  C:ribonuclease P complex  
GO:0001682  P:tRNA 5'-leader removal  
KEGG mgl:MGL_2197  -  
Pfam View protein in Pfam  
PF08584  Ribonuc_P_40  
Amino Acid Sequences MAARSTHKRKRSAKRADNERGKPGGLGGGRLTLSLYEWSPSAREELKRALYTHPFNHTVDVLVPHASFPTQNFISSLQRILQNAGSGPCIAHVPLALFLEPTFVAQYIRTGSLYALSATWLDTQDSVCLDGQGMLVLSVTKDTYQQLGLVGRPSRFARGASGRKADRHSGAISRYIIELPLLDPSFIPGKRGYERAKQCLLAWDQARSKSSAVPMLINGVPASWSMLLVWTPPELTTTETPFLHGHRIWAPIEYAPLQQAHVMQALAPTLQMNSCTDVWIPPAPMLATSFESVPGDRWTSICEYLEWTGLASMRAPRLQTYDRCDPRIAMYAPISGSCPGSFLHVHIRGMLPPSLLSCVLDCMWDELDVSPRSAWASITVNGFSDSPIAWTSKYPGLGLALGSASSRSDAFRDGYNAAQRARKVRRKSHTRRGESEHGLFRTGENGWTMLLSSDRSQHKGHVALIDSVELDTHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.92
3 0.93
4 0.93
5 0.88
6 0.85
7 0.77
8 0.67
9 0.57
10 0.47
11 0.43
12 0.33
13 0.28
14 0.21
15 0.22
16 0.21
17 0.2
18 0.2
19 0.13
20 0.14
21 0.14
22 0.14
23 0.11
24 0.11
25 0.12
26 0.13
27 0.14
28 0.17
29 0.21
30 0.23
31 0.26
32 0.34
33 0.39
34 0.42
35 0.43
36 0.44
37 0.47
38 0.5
39 0.51
40 0.5
41 0.47
42 0.45
43 0.46
44 0.39
45 0.32
46 0.28
47 0.25
48 0.2
49 0.18
50 0.17
51 0.15
52 0.15
53 0.14
54 0.13
55 0.12
56 0.18
57 0.16
58 0.17
59 0.18
60 0.21
61 0.26
62 0.26
63 0.27
64 0.23
65 0.25
66 0.25
67 0.27
68 0.25
69 0.21
70 0.21
71 0.2
72 0.18
73 0.15
74 0.14
75 0.12
76 0.12
77 0.1
78 0.08
79 0.08
80 0.08
81 0.1
82 0.11
83 0.1
84 0.1
85 0.09
86 0.11
87 0.1
88 0.1
89 0.09
90 0.08
91 0.08
92 0.08
93 0.1
94 0.11
95 0.12
96 0.12
97 0.11
98 0.11
99 0.12
100 0.13
101 0.11
102 0.09
103 0.08
104 0.08
105 0.09
106 0.1
107 0.09
108 0.09
109 0.09
110 0.1
111 0.1
112 0.11
113 0.11
114 0.1
115 0.09
116 0.09
117 0.09
118 0.08
119 0.07
120 0.07
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.09
131 0.09
132 0.1
133 0.11
134 0.12
135 0.13
136 0.16
137 0.18
138 0.17
139 0.2
140 0.2
141 0.22
142 0.21
143 0.21
144 0.22
145 0.29
146 0.35
147 0.37
148 0.43
149 0.42
150 0.45
151 0.48
152 0.46
153 0.38
154 0.35
155 0.32
156 0.29
157 0.28
158 0.29
159 0.26
160 0.23
161 0.21
162 0.18
163 0.16
164 0.12
165 0.11
166 0.07
167 0.1
168 0.09
169 0.09
170 0.08
171 0.1
172 0.15
173 0.14
174 0.16
175 0.13
176 0.17
177 0.19
178 0.26
179 0.29
180 0.33
181 0.39
182 0.43
183 0.45
184 0.42
185 0.4
186 0.4
187 0.38
188 0.34
189 0.29
190 0.28
191 0.28
192 0.29
193 0.3
194 0.25
195 0.23
196 0.2
197 0.2
198 0.19
199 0.17
200 0.15
201 0.14
202 0.16
203 0.15
204 0.13
205 0.12
206 0.08
207 0.08
208 0.07
209 0.08
210 0.05
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.06
222 0.08
223 0.1
224 0.12
225 0.14
226 0.13
227 0.15
228 0.15
229 0.16
230 0.17
231 0.16
232 0.15
233 0.15
234 0.18
235 0.17
236 0.17
237 0.17
238 0.13
239 0.14
240 0.13
241 0.11
242 0.1
243 0.1
244 0.1
245 0.09
246 0.1
247 0.09
248 0.09
249 0.08
250 0.07
251 0.07
252 0.07
253 0.06
254 0.06
255 0.05
256 0.04
257 0.05
258 0.05
259 0.06
260 0.08
261 0.09
262 0.09
263 0.09
264 0.09
265 0.12
266 0.12
267 0.12
268 0.09
269 0.1
270 0.09
271 0.09
272 0.1
273 0.09
274 0.09
275 0.09
276 0.09
277 0.09
278 0.1
279 0.1
280 0.1
281 0.1
282 0.11
283 0.1
284 0.1
285 0.12
286 0.14
287 0.16
288 0.15
289 0.13
290 0.14
291 0.15
292 0.15
293 0.13
294 0.1
295 0.1
296 0.1
297 0.1
298 0.08
299 0.1
300 0.11
301 0.13
302 0.13
303 0.14
304 0.18
305 0.24
306 0.27
307 0.32
308 0.4
309 0.43
310 0.46
311 0.45
312 0.41
313 0.38
314 0.41
315 0.35
316 0.27
317 0.24
318 0.23
319 0.23
320 0.22
321 0.2
322 0.14
323 0.14
324 0.11
325 0.11
326 0.09
327 0.12
328 0.11
329 0.12
330 0.2
331 0.22
332 0.22
333 0.23
334 0.24
335 0.22
336 0.25
337 0.24
338 0.16
339 0.13
340 0.13
341 0.14
342 0.13
343 0.12
344 0.09
345 0.11
346 0.1
347 0.11
348 0.1
349 0.1
350 0.1
351 0.1
352 0.11
353 0.09
354 0.15
355 0.16
356 0.17
357 0.14
358 0.14
359 0.15
360 0.15
361 0.14
362 0.12
363 0.14
364 0.16
365 0.18
366 0.18
367 0.18
368 0.18
369 0.18
370 0.15
371 0.13
372 0.1
373 0.1
374 0.11
375 0.11
376 0.11
377 0.12
378 0.16
379 0.18
380 0.19
381 0.18
382 0.17
383 0.18
384 0.18
385 0.17
386 0.14
387 0.1
388 0.09
389 0.09
390 0.08
391 0.07
392 0.07
393 0.08
394 0.08
395 0.09
396 0.12
397 0.13
398 0.16
399 0.19
400 0.2
401 0.24
402 0.3
403 0.32
404 0.33
405 0.36
406 0.37
407 0.43
408 0.52
409 0.56
410 0.6
411 0.67
412 0.74
413 0.81
414 0.88
415 0.89
416 0.9
417 0.89
418 0.87
419 0.86
420 0.84
421 0.8
422 0.77
423 0.74
424 0.64
425 0.58
426 0.5
427 0.41
428 0.35
429 0.29
430 0.23
431 0.16
432 0.15
433 0.13
434 0.13
435 0.13
436 0.11
437 0.11
438 0.12
439 0.13
440 0.2
441 0.24
442 0.28
443 0.29
444 0.33
445 0.38
446 0.39
447 0.41
448 0.39
449 0.37
450 0.36
451 0.36
452 0.32
453 0.26
454 0.22