FuNGI

A8Q2I0

Protein Details

Accession

A8Q2I0

Localization Confidence

Medium

Confidence Score

14.8

NoLS Segment(s)

Position	Sequence	Protein Nature
1-25	MAARSTHKRKRSAKRADNERGKPGG	Basic
413-440	DGYNAAQRARKVRRKSHTRRGESEHGLF	Hydrophilic

NLS Segment(s)

Position	Sequence
7-24	HKRKRSAKRADNERGKPG
420-432	RARKVRRKSHTRR

Subcellular Location(s)

mito 16, nucl 8.5, cyto_nucl 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR013893 RNase_P_Rpp40
Gene Ontology	GO:0030677 C:ribonuclease P complex GO:0001682 P:tRNA 5'-leader removal
KEGG	mgl:MGL_2197 -
Pfam	View protein in Pfam PF08584 Ribonuc_P_40

Amino Acid Sequences

MAARSTHKRKRSAKRADNERGKPGGLGGGRLTLSLYEWSPSAREELKRALYTHPFNHTVDVLVPHASFPTQNFISSLQRILQNAGSGPCIAHVPLALFLEPTFVAQYIRTGSLYALSATWLDTQDSVCLDGQGMLVLSVTKDTYQQLGLVGRPSRFARGASGRKADRHSGAISRYIIELPLLDPSFIPGKRGYERAKQCLLAWDQARSKSSAVPMLINGVPASWSMLLVWTPPELTTTETPFLHGHRIWAPIEYAPLQQAHVMQALAPTLQMNSCTDVWIPPAPMLATSFESVPGDRWTSICEYLEWTGLASMRAPRLQTYDRCDPRIAMYAPISGSCPGSFLHVHIRGMLPPSLLSCVLDCMWDELDVSPRSAWASITVNGFSDSPIAWTSKYPGLGLALGSASSRSDAFRDGYNAAQRARKVRRKSHTRRGESEHGLFRTGENGWTMLLSSDRSQHKGHVALIDSVELDTHM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.89
2	0.92
3	0.93
4	0.93
5	0.88
6	0.85
7	0.77
8	0.67
9	0.57
10	0.47
11	0.43
12	0.33
13	0.28
14	0.21
15	0.22
16	0.21
17	0.2
18	0.2
19	0.13
20	0.14
21	0.14
22	0.14
23	0.11
24	0.11
25	0.12
26	0.13
27	0.14
28	0.17
29	0.21
30	0.23
31	0.26
32	0.34
33	0.39
34	0.42
35	0.43
36	0.44
37	0.47
38	0.5
39	0.51
40	0.5
41	0.47
42	0.45
43	0.46
44	0.39
45	0.32
46	0.28
47	0.25
48	0.2
49	0.18
50	0.17
51	0.15
52	0.15
53	0.14
54	0.13
55	0.12
56	0.18
57	0.16
58	0.17
59	0.18
60	0.21
61	0.26
62	0.26
63	0.27
64	0.23
65	0.25
66	0.25
67	0.27
68	0.25
69	0.21
70	0.21
71	0.2
72	0.18
73	0.15
74	0.14
75	0.12
76	0.12
77	0.1
78	0.08
79	0.08
80	0.08
81	0.1
82	0.11
83	0.1
84	0.1
85	0.09
86	0.11
87	0.1
88	0.1
89	0.09
90	0.08
91	0.08
92	0.08
93	0.1
94	0.11
95	0.12
96	0.12
97	0.11
98	0.11
99	0.12
100	0.13
101	0.11
102	0.09
103	0.08
104	0.08
105	0.09
106	0.1
107	0.09
108	0.09
109	0.09
110	0.1
111	0.1
112	0.11
113	0.11
114	0.1
115	0.09
116	0.09
117	0.09
118	0.08
119	0.07
120	0.07
121	0.05
122	0.05
123	0.05
124	0.05
125	0.05
126	0.05
127	0.05
128	0.06
129	0.07
130	0.09
131	0.09
132	0.1
133	0.11
134	0.12
135	0.13
136	0.16
137	0.18
138	0.17
139	0.2
140	0.2
141	0.22
142	0.21
143	0.21
144	0.22
145	0.29
146	0.35
147	0.37
148	0.43
149	0.42
150	0.45
151	0.48
152	0.46
153	0.38
154	0.35
155	0.32
156	0.29
157	0.28
158	0.29
159	0.26
160	0.23
161	0.21
162	0.18
163	0.16
164	0.12
165	0.11
166	0.07
167	0.1
168	0.09
169	0.09
170	0.08
171	0.1
172	0.15
173	0.14
174	0.16
175	0.13
176	0.17
177	0.19
178	0.26
179	0.29
180	0.33
181	0.39
182	0.43
183	0.45
184	0.42
185	0.4
186	0.4
187	0.38
188	0.34
189	0.29
190	0.28
191	0.28
192	0.29
193	0.3
194	0.25
195	0.23
196	0.2
197	0.2
198	0.19
199	0.17
200	0.15
201	0.14
202	0.16
203	0.15
204	0.13
205	0.12
206	0.08
207	0.08
208	0.07
209	0.08
210	0.05
211	0.04
212	0.04
213	0.05
214	0.05
215	0.05
216	0.05
217	0.05
218	0.05
219	0.05
220	0.06
221	0.06
222	0.08
223	0.1
224	0.12
225	0.14
226	0.13
227	0.15
228	0.15
229	0.16
230	0.17
231	0.16
232	0.15
233	0.15
234	0.18
235	0.17
236	0.17
237	0.17
238	0.13
239	0.14
240	0.13
241	0.11
242	0.1
243	0.1
244	0.1
245	0.09
246	0.1
247	0.09
248	0.09
249	0.08
250	0.07
251	0.07
252	0.07
253	0.06
254	0.06
255	0.05
256	0.04
257	0.05
258	0.05
259	0.06
260	0.08
261	0.09
262	0.09
263	0.09
264	0.09
265	0.12
266	0.12
267	0.12
268	0.09
269	0.1
270	0.09
271	0.09
272	0.1
273	0.09
274	0.09
275	0.09
276	0.09
277	0.09
278	0.1
279	0.1
280	0.1
281	0.1
282	0.11
283	0.1
284	0.1
285	0.12
286	0.14
287	0.16
288	0.15
289	0.13
290	0.14
291	0.15
292	0.15
293	0.13
294	0.1
295	0.1
296	0.1
297	0.1
298	0.08
299	0.1
300	0.11
301	0.13
302	0.13
303	0.14
304	0.18
305	0.24
306	0.27
307	0.32
308	0.4
309	0.43
310	0.46
311	0.45
312	0.41
313	0.38
314	0.41
315	0.35
316	0.27
317	0.24
318	0.23
319	0.23
320	0.22
321	0.2
322	0.14
323	0.14
324	0.11
325	0.11
326	0.09
327	0.12
328	0.11
329	0.12
330	0.2
331	0.22
332	0.22
333	0.23
334	0.24
335	0.22
336	0.25
337	0.24
338	0.16
339	0.13
340	0.13
341	0.14
342	0.13
343	0.12
344	0.09
345	0.11
346	0.1
347	0.11
348	0.1
349	0.1
350	0.1
351	0.1
352	0.11
353	0.09
354	0.15
355	0.16
356	0.17
357	0.14
358	0.14
359	0.15
360	0.15
361	0.14
362	0.12
363	0.14
364	0.16
365	0.18
366	0.18
367	0.18
368	0.18
369	0.18
370	0.15
371	0.13
372	0.1
373	0.1
374	0.11
375	0.11
376	0.11
377	0.12
378	0.16
379	0.18
380	0.19
381	0.18
382	0.17
383	0.18
384	0.18
385	0.17
386	0.14
387	0.1
388	0.09
389	0.09
390	0.08
391	0.07
392	0.07
393	0.08
394	0.08
395	0.09
396	0.12
397	0.13
398	0.16
399	0.19
400	0.2
401	0.24
402	0.3
403	0.32
404	0.33
405	0.36
406	0.37
407	0.43
408	0.52
409	0.56
410	0.6
411	0.67
412	0.74
413	0.81
414	0.88
415	0.89
416	0.9
417	0.89
418	0.87
419	0.86
420	0.84
421	0.8
422	0.77
423	0.74
424	0.64
425	0.58
426	0.5
427	0.41
428	0.35
429	0.29
430	0.23
431	0.16
432	0.15
433	0.13
434	0.13
435	0.13
436	0.11
437	0.11
438	0.12
439	0.13
440	0.2
441	0.24
442	0.28
443	0.29
444	0.33
445	0.38
446	0.39
447	0.41
448	0.39
449	0.37
450	0.36
451	0.36
452	0.32
453	0.26
454	0.22

A8Q2I0

3D AlphaFold-predicted Structure Viewer