Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8Q2P2

Protein Details
Accession A8Q2P2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-107RKSVHKVPKFTRKTLRVNPRGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto_mito 13.333, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG mgl:MGL_2216  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSFLGAFRPSASAFSGLLWKNPWRMSATRKARVRQRLRDVDTVIDTIRTSGVQCRALECAKQLPTESEMHPRDKYMVFSPHGANFRKSVHKVPKFTRKTLRVNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.21
3 0.19
4 0.2
5 0.22
6 0.23
7 0.26
8 0.27
9 0.28
10 0.26
11 0.29
12 0.35
13 0.42
14 0.49
15 0.53
16 0.58
17 0.62
18 0.67
19 0.73
20 0.76
21 0.75
22 0.76
23 0.76
24 0.75
25 0.73
26 0.66
27 0.57
28 0.49
29 0.4
30 0.3
31 0.21
32 0.15
33 0.11
34 0.09
35 0.07
36 0.06
37 0.09
38 0.12
39 0.15
40 0.15
41 0.15
42 0.18
43 0.18
44 0.18
45 0.17
46 0.18
47 0.16
48 0.17
49 0.16
50 0.15
51 0.18
52 0.2
53 0.2
54 0.24
55 0.26
56 0.29
57 0.29
58 0.28
59 0.28
60 0.26
61 0.28
62 0.24
63 0.27
64 0.25
65 0.27
66 0.29
67 0.31
68 0.36
69 0.36
70 0.33
71 0.3
72 0.33
73 0.39
74 0.4
75 0.44
76 0.49
77 0.55
78 0.62
79 0.68
80 0.74
81 0.73
82 0.78
83 0.79
84 0.76
85 0.78
86 0.8
87 0.82