Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8PS50

Protein Details
Accession A8PS50    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
115-137VMGGIRRSKRRRLVRRQNGEEASHydrophilic
NLS Segment(s)
PositionSequence
120-127RRSKRRRL
Subcellular Location(s) cyto_nucl 10.5, cyto 10, nucl 9, mito 8
Family & Domain DBs
KEGG mgl:MGL_0194  -  
Amino Acid Sequences MDLATRIATAYDAACVRAATPGVAESDTSTAGGFIVDVNDETAGGFVRETSCFSNSNASPVLPVSALPYALDTLELEGAKRRDVQELLEAHSGYDEMHAEPVVPRTYFLEAVEAVMGGIRRSKRRRLVRRQNGEEASSNSDGGTASQDEYAPPDKEPAFSSDEDDTGARDENDRAASSMSSAQVSKHDKNTNISKAKKEQGRLLYRLLLERIPLVAPTMLANYPSIGIREDVTDEEIESRQIGIDELRYATRSLGESRSTSELADMLYEAQALASNSTQTRSRAPAEAPRIGLNEFTFITGRAGVIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.14
5 0.14
6 0.1
7 0.11
8 0.11
9 0.12
10 0.12
11 0.12
12 0.11
13 0.12
14 0.12
15 0.12
16 0.1
17 0.08
18 0.08
19 0.08
20 0.06
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.05
33 0.05
34 0.07
35 0.08
36 0.11
37 0.14
38 0.16
39 0.17
40 0.18
41 0.25
42 0.23
43 0.27
44 0.25
45 0.22
46 0.21
47 0.2
48 0.2
49 0.12
50 0.12
51 0.1
52 0.1
53 0.1
54 0.09
55 0.1
56 0.09
57 0.09
58 0.09
59 0.06
60 0.07
61 0.09
62 0.09
63 0.08
64 0.13
65 0.14
66 0.15
67 0.18
68 0.18
69 0.2
70 0.21
71 0.22
72 0.24
73 0.25
74 0.27
75 0.27
76 0.26
77 0.21
78 0.21
79 0.19
80 0.12
81 0.11
82 0.08
83 0.06
84 0.07
85 0.07
86 0.07
87 0.08
88 0.11
89 0.12
90 0.11
91 0.11
92 0.12
93 0.14
94 0.15
95 0.14
96 0.13
97 0.11
98 0.11
99 0.11
100 0.09
101 0.06
102 0.06
103 0.06
104 0.05
105 0.08
106 0.11
107 0.19
108 0.24
109 0.32
110 0.41
111 0.52
112 0.62
113 0.7
114 0.79
115 0.82
116 0.88
117 0.86
118 0.84
119 0.75
120 0.67
121 0.57
122 0.48
123 0.42
124 0.31
125 0.25
126 0.17
127 0.16
128 0.13
129 0.11
130 0.1
131 0.06
132 0.06
133 0.07
134 0.07
135 0.06
136 0.09
137 0.12
138 0.11
139 0.11
140 0.13
141 0.13
142 0.14
143 0.15
144 0.15
145 0.16
146 0.15
147 0.18
148 0.16
149 0.16
150 0.15
151 0.14
152 0.12
153 0.09
154 0.09
155 0.07
156 0.07
157 0.07
158 0.09
159 0.1
160 0.1
161 0.09
162 0.09
163 0.09
164 0.09
165 0.11
166 0.09
167 0.09
168 0.09
169 0.09
170 0.15
171 0.21
172 0.22
173 0.28
174 0.32
175 0.33
176 0.38
177 0.46
178 0.49
179 0.51
180 0.52
181 0.51
182 0.53
183 0.58
184 0.57
185 0.52
186 0.5
187 0.52
188 0.55
189 0.52
190 0.48
191 0.45
192 0.41
193 0.39
194 0.34
195 0.25
196 0.18
197 0.16
198 0.14
199 0.11
200 0.1
201 0.09
202 0.08
203 0.07
204 0.08
205 0.09
206 0.08
207 0.09
208 0.09
209 0.08
210 0.09
211 0.09
212 0.09
213 0.08
214 0.08
215 0.08
216 0.09
217 0.1
218 0.1
219 0.12
220 0.11
221 0.11
222 0.12
223 0.12
224 0.11
225 0.1
226 0.09
227 0.08
228 0.08
229 0.08
230 0.07
231 0.08
232 0.09
233 0.11
234 0.11
235 0.12
236 0.13
237 0.13
238 0.14
239 0.15
240 0.16
241 0.19
242 0.21
243 0.21
244 0.24
245 0.28
246 0.26
247 0.24
248 0.21
249 0.18
250 0.15
251 0.14
252 0.11
253 0.08
254 0.08
255 0.07
256 0.07
257 0.06
258 0.08
259 0.07
260 0.09
261 0.08
262 0.11
263 0.12
264 0.15
265 0.18
266 0.19
267 0.23
268 0.26
269 0.29
270 0.31
271 0.35
272 0.41
273 0.45
274 0.48
275 0.46
276 0.44
277 0.42
278 0.39
279 0.37
280 0.28
281 0.24
282 0.2
283 0.2
284 0.17
285 0.16
286 0.17
287 0.15