Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8QB18

Protein Details
Accession A8QB18    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKVRWTKAFRKAAGKEBasic
NLS Segment(s)
PositionSequence
6-9RKVR
61-84RRERAFYRARMAKAAGGNVKAKAK
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
KEGG mgl:MGL_3870  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKVRWTKAFRKAAGKEMTVDSTLEFEKRRNVPVRYDRELVTATLNAMQRIQEIKARRERAFYRARMAKAAGGNVKAKAKEVDRLAVHRNQHLRRAIQADAAKAERQKVKVAARKSALVSAGDDGMAMGMQTDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.76
4 0.74
5 0.69
6 0.6
7 0.52
8 0.46
9 0.42
10 0.33
11 0.3
12 0.21
13 0.18
14 0.17
15 0.16
16 0.15
17 0.14
18 0.21
19 0.23
20 0.31
21 0.36
22 0.37
23 0.45
24 0.53
25 0.6
26 0.58
27 0.57
28 0.5
29 0.46
30 0.44
31 0.35
32 0.27
33 0.19
34 0.14
35 0.16
36 0.16
37 0.13
38 0.13
39 0.12
40 0.11
41 0.13
42 0.13
43 0.13
44 0.16
45 0.22
46 0.3
47 0.35
48 0.35
49 0.39
50 0.4
51 0.43
52 0.47
53 0.43
54 0.42
55 0.43
56 0.42
57 0.38
58 0.37
59 0.32
60 0.25
61 0.26
62 0.21
63 0.18
64 0.18
65 0.19
66 0.21
67 0.18
68 0.18
69 0.18
70 0.17
71 0.2
72 0.21
73 0.24
74 0.23
75 0.26
76 0.29
77 0.31
78 0.32
79 0.32
80 0.39
81 0.36
82 0.42
83 0.43
84 0.41
85 0.41
86 0.42
87 0.37
88 0.35
89 0.35
90 0.3
91 0.28
92 0.29
93 0.27
94 0.25
95 0.3
96 0.28
97 0.28
98 0.31
99 0.35
100 0.42
101 0.47
102 0.5
103 0.53
104 0.51
105 0.53
106 0.5
107 0.46
108 0.39
109 0.33
110 0.3
111 0.23
112 0.2
113 0.16
114 0.14
115 0.1
116 0.08
117 0.07
118 0.05