Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8PZP8

Protein Details
Accession A8PZP8   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-38MGKRQHTKTHTICRRCNRRAFHRQHKTCASCHydrophilic
NLS Segment(s)
PositionSequence
52-75KKAIRRKTTGSGRMRYLKTLPRRA
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgl:MGL_1938  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTTSMGKRQHTKTHTICRRCNRRAFHRQHKTCASCGYPSAKTRNYQWGKKAIRRKTTGSGRMRYLKTLPRRAKNGFRTGTATPASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.7
4 0.72
5 0.73
6 0.76
7 0.77
8 0.84
9 0.82
10 0.82
11 0.79
12 0.8
13 0.82
14 0.83
15 0.84
16 0.84
17 0.81
18 0.81
19 0.81
20 0.73
21 0.65
22 0.58
23 0.49
24 0.39
25 0.36
26 0.33
27 0.28
28 0.28
29 0.31
30 0.3
31 0.29
32 0.31
33 0.39
34 0.4
35 0.41
36 0.42
37 0.46
38 0.5
39 0.56
40 0.63
41 0.6
42 0.63
43 0.63
44 0.64
45 0.64
46 0.67
47 0.69
48 0.68
49 0.64
50 0.61
51 0.65
52 0.61
53 0.55
54 0.51
55 0.5
56 0.52
57 0.58
58 0.61
59 0.61
60 0.68
61 0.72
62 0.77
63 0.77
64 0.77
65 0.7
66 0.64
67 0.61
68 0.55
69 0.53