Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PUS5

Protein Details
Accession A8PUS5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-90GSEYQPSQRKRKRKHGFLARLRSRTGKKVLARRRAKGKTBasic
NLS Segment(s)
PositionSequence
60-90RKRKRKHGFLARLRSRTGKKVLARRRAKGKT
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgl:MGL_0761  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPIAYARTASSLSARLRSPSPILSMARHALLPQRQMPFHIPQLGGVRFTTYGSEYQPSQRKRKRKHGFLARLRSRTGKKVLARRRAKGKTAVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.28
5 0.29
6 0.25
7 0.25
8 0.26
9 0.27
10 0.26
11 0.28
12 0.26
13 0.24
14 0.22
15 0.19
16 0.2
17 0.21
18 0.23
19 0.25
20 0.26
21 0.25
22 0.28
23 0.31
24 0.29
25 0.29
26 0.28
27 0.24
28 0.23
29 0.27
30 0.25
31 0.22
32 0.19
33 0.17
34 0.13
35 0.13
36 0.12
37 0.08
38 0.09
39 0.09
40 0.1
41 0.11
42 0.17
43 0.25
44 0.3
45 0.39
46 0.46
47 0.55
48 0.63
49 0.74
50 0.78
51 0.8
52 0.85
53 0.86
54 0.89
55 0.89
56 0.91
57 0.88
58 0.81
59 0.73
60 0.7
61 0.64
62 0.6
63 0.56
64 0.54
65 0.53
66 0.6
67 0.68
68 0.71
69 0.75
70 0.76
71 0.8
72 0.8
73 0.78
74 0.77