FuNGI

Q2HGP5

Protein Details

Accession

Q2HGP5

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
66-99	RLNYAERKKARQELAKQRPNFKIRKGKKDITMYP	Hydrophilic
160-182	LQAPRRTARKSARRRDGKGDRDM	Basic

NLS Segment(s)

Position	Sequence
70-93	AERKKARQELAKQRPNFKIRKGKK
164-177	RRTARKSARRRDGK

Subcellular Location(s)

mito 12, extr 7, mito_nucl 7

Family & Domain DBs

InterPro	View protein in InterPro IPR029028 Alpha/beta_knot_MTases IPR047182 MRM1 IPR047261 MRM1_MeTrfase_dom IPR001537 SpoU_MeTrfase IPR029026 tRNA_m1G_MTases_N
Gene Ontology	GO:0003723 F:RNA binding GO:0008173 F:RNA methyltransferase activity GO:0031167 P:rRNA methylation
Pfam	View protein in Pfam PF00588 SpoU_methylase
CDD	cd18105 SpoU-like_MRM1

Amino Acid Sequences

MSLSLVYRAARSSLLANSIPRISLTAFPARHASLSAINRGLVRSEKARPQGARSDKFNDLAEGGKRLNYAERKKARQELAKQRPNFKIRKGKKDITMYPEKAKAQSRQARFYDPKSSFGKKSLVYKMKTGQLSEELKALQPEDSGSTNSAFERTGLRPDLQAPRRTARKSARRRDGKGDRDMVDAADFIAALSQPAHSSSDGGRRDAPSRSRDGAGSTSAAGKHRDAPPRGRDSFGGKDASQTRDSFGSGNASRDSSFKTRDSSSKAHDTSFNVHDTSARPRPSPRQERDGSRDFSRRDRDTDRRFRDAPRPERDSFAPRDSPRRDREYDRDFEGAPHPEQDTSSLRTDQALFSITYTTAASQFLYGKSVRKNIPTTILGEDGMRLLDKMASSRPHNGFVLEASPLPQPPLTALAPVPEDYASNPRCAITLGHQSAEEAAINGHPTSIPTLSPTHKPLVLILDQILDPGNLGAILRTASFLGATAVGITRHGSAPLTPVALKASSGAAESLSLFSVSSLPEFLNASRANGWAVYAAVAEGPSSERRQRRHVDVRDVTETDPLKREPCVLLVGNEGEGLSRLVVKKADYEVNVPNLAMPGSGVDSLNVSVAVGLLCSAFLSGVSREMGGFGALKGLGGGGEGVKENLW

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.23
3	0.24
4	0.26
5	0.26
6	0.25
7	0.22
8	0.22
9	0.19
10	0.2
11	0.24
12	0.29
13	0.28
14	0.3
15	0.34
16	0.33
17	0.31
18	0.28
19	0.26
20	0.25
21	0.29
22	0.32
23	0.29
24	0.3
25	0.3
26	0.29
27	0.3
28	0.25
29	0.25
30	0.26
31	0.31
32	0.37
33	0.43
34	0.5
35	0.5
36	0.53
37	0.58
38	0.63
39	0.63
40	0.61
41	0.6
42	0.56
43	0.56
44	0.52
45	0.43
46	0.34
47	0.32
48	0.29
49	0.27
50	0.24
51	0.22
52	0.22
53	0.21
54	0.28
55	0.33
56	0.39
57	0.45
58	0.54
59	0.6
60	0.67
61	0.75
62	0.75
63	0.75
64	0.78
65	0.79
66	0.81
67	0.82
68	0.8
69	0.8
70	0.81
71	0.81
72	0.77
73	0.75
74	0.75
75	0.76
76	0.81
77	0.82
78	0.8
79	0.8
80	0.83
81	0.8
82	0.77
83	0.78
84	0.71
85	0.67
86	0.66
87	0.6
88	0.55
89	0.55
90	0.53
91	0.53
92	0.57
93	0.58
94	0.6
95	0.61
96	0.65
97	0.64
98	0.62
99	0.62
100	0.55
101	0.55
102	0.52
103	0.55
104	0.48
105	0.48
106	0.49
107	0.42
108	0.48
109	0.52
110	0.54
111	0.51
112	0.53
113	0.54
114	0.56
115	0.55
116	0.47
117	0.4
118	0.39
119	0.4
120	0.36
121	0.32
122	0.26
123	0.25
124	0.25
125	0.22
126	0.15
127	0.12
128	0.12
129	0.12
130	0.13
131	0.13
132	0.13
133	0.14
134	0.14
135	0.14
136	0.14
137	0.12
138	0.11
139	0.15
140	0.15
141	0.19
142	0.21
143	0.21
144	0.22
145	0.27
146	0.36
147	0.38
148	0.43
149	0.42
150	0.47
151	0.54
152	0.55
153	0.58
154	0.59
155	0.63
156	0.68
157	0.74
158	0.77
159	0.79
160	0.82
161	0.84
162	0.84
163	0.81
164	0.79
165	0.74
166	0.65
167	0.58
168	0.53
169	0.42
170	0.33
171	0.24
172	0.16
173	0.09
174	0.08
175	0.05
176	0.05
177	0.04
178	0.04
179	0.04
180	0.04
181	0.05
182	0.06
183	0.08
184	0.07
185	0.09
186	0.12
187	0.2
188	0.21
189	0.23
190	0.24
191	0.25
192	0.28
193	0.32
194	0.35
195	0.31
196	0.35
197	0.36
198	0.34
199	0.33
200	0.32
201	0.29
202	0.24
203	0.21
204	0.16
205	0.15
206	0.15
207	0.17
208	0.16
209	0.15
210	0.2
211	0.26
212	0.33
213	0.35
214	0.41
215	0.47
216	0.53
217	0.54
218	0.5
219	0.45
220	0.43
221	0.44
222	0.39
223	0.35
224	0.26
225	0.3
226	0.32
227	0.34
228	0.3
229	0.26
230	0.24
231	0.22
232	0.23
233	0.18
234	0.15
235	0.18
236	0.16
237	0.18
238	0.17
239	0.17
240	0.17
241	0.17
242	0.21
243	0.18
244	0.21
245	0.2
246	0.23
247	0.25
248	0.28
249	0.34
250	0.33
251	0.35
252	0.39
253	0.39
254	0.37
255	0.37
256	0.35
257	0.34
258	0.33
259	0.29
260	0.21
261	0.2
262	0.2
263	0.19
264	0.24
265	0.25
266	0.24
267	0.24
268	0.27
269	0.36
270	0.45
271	0.54
272	0.51
273	0.54
274	0.57
275	0.62
276	0.65
277	0.63
278	0.56
279	0.5
280	0.52
281	0.45
282	0.47
283	0.48
284	0.43
285	0.42
286	0.46
287	0.51
288	0.55
289	0.63
290	0.62
291	0.61
292	0.61
293	0.6
294	0.61
295	0.61
296	0.6
297	0.57
298	0.58
299	0.53
300	0.54
301	0.52
302	0.49
303	0.43
304	0.38
305	0.37
306	0.32
307	0.4
308	0.42
309	0.47
310	0.46
311	0.49
312	0.48
313	0.47
314	0.54
315	0.52
316	0.5
317	0.46
318	0.42
319	0.36
320	0.33
321	0.31
322	0.26
323	0.19
324	0.18
325	0.15
326	0.14
327	0.14
328	0.15
329	0.15
330	0.15
331	0.17
332	0.16
333	0.16
334	0.17
335	0.18
336	0.15
337	0.13
338	0.11
339	0.09
340	0.08
341	0.09
342	0.08
343	0.08
344	0.08
345	0.08
346	0.07
347	0.07
348	0.07
349	0.07
350	0.08
351	0.08
352	0.1
353	0.11
354	0.14
355	0.16
356	0.22
357	0.23
358	0.27
359	0.29
360	0.28
361	0.33
362	0.3
363	0.3
364	0.26
365	0.24
366	0.2
367	0.17
368	0.16
369	0.11
370	0.1
371	0.07
372	0.05
373	0.04
374	0.05
375	0.05
376	0.07
377	0.1
378	0.13
379	0.16
380	0.23
381	0.25
382	0.27
383	0.27
384	0.26
385	0.23
386	0.2
387	0.19
388	0.12
389	0.1
390	0.09
391	0.1
392	0.09
393	0.1
394	0.09
395	0.08
396	0.08
397	0.12
398	0.11
399	0.11
400	0.11
401	0.12
402	0.13
403	0.13
404	0.13
405	0.09
406	0.09
407	0.09
408	0.18
409	0.17
410	0.17
411	0.17
412	0.16
413	0.16
414	0.17
415	0.17
416	0.14
417	0.23
418	0.23
419	0.23
420	0.23
421	0.23
422	0.22
423	0.22
424	0.17
425	0.07
426	0.06
427	0.06
428	0.07
429	0.07
430	0.06
431	0.06
432	0.06
433	0.08
434	0.09
435	0.08
436	0.1
437	0.14
438	0.16
439	0.2
440	0.23
441	0.24
442	0.24
443	0.24
444	0.23
445	0.24
446	0.23
447	0.2
448	0.17
449	0.15
450	0.14
451	0.14
452	0.13
453	0.08
454	0.07
455	0.06
456	0.05
457	0.04
458	0.04
459	0.04
460	0.04
461	0.04
462	0.04
463	0.05
464	0.05
465	0.05
466	0.05
467	0.05
468	0.06
469	0.05
470	0.05
471	0.05
472	0.06
473	0.06
474	0.06
475	0.07
476	0.08
477	0.08
478	0.09
479	0.09
480	0.09
481	0.12
482	0.13
483	0.13
484	0.12
485	0.12
486	0.14
487	0.13
488	0.13
489	0.11
490	0.1
491	0.09
492	0.09
493	0.09
494	0.07
495	0.07
496	0.08
497	0.08
498	0.07
499	0.07
500	0.06
501	0.06
502	0.07
503	0.07
504	0.07
505	0.08
506	0.07
507	0.08
508	0.1
509	0.1
510	0.15
511	0.15
512	0.17
513	0.17
514	0.18
515	0.18
516	0.16
517	0.16
518	0.1
519	0.1
520	0.08
521	0.07
522	0.06
523	0.06
524	0.06
525	0.05
526	0.05
527	0.07
528	0.1
529	0.15
530	0.23
531	0.29
532	0.34
533	0.43
534	0.49
535	0.57
536	0.65
537	0.69
538	0.72
539	0.73
540	0.75
541	0.72
542	0.66
543	0.57
544	0.52
545	0.46
546	0.38
547	0.35
548	0.31
549	0.27
550	0.26
551	0.29
552	0.24
553	0.24
554	0.26
555	0.23
556	0.23
557	0.24
558	0.24
559	0.21
560	0.19
561	0.17
562	0.12
563	0.11
564	0.1
565	0.07
566	0.1
567	0.11
568	0.13
569	0.15
570	0.16
571	0.19
572	0.23
573	0.28
574	0.26
575	0.3
576	0.33
577	0.36
578	0.35
579	0.31
580	0.27
581	0.23
582	0.21
583	0.16
584	0.11
585	0.08
586	0.09
587	0.1
588	0.1
589	0.09
590	0.1
591	0.11
592	0.11
593	0.1
594	0.07
595	0.06
596	0.06
597	0.06
598	0.05
599	0.05
600	0.04
601	0.04
602	0.04
603	0.04
604	0.04
605	0.04
606	0.07
607	0.08
608	0.1
609	0.11
610	0.11
611	0.11
612	0.12
613	0.12
614	0.1
615	0.11
616	0.08
617	0.1
618	0.09
619	0.09
620	0.08
621	0.08
622	0.07
623	0.06
624	0.07
625	0.05
626	0.07
627	0.07

Q2HGP5

3D AlphaFold-predicted Structure Viewer