Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PVZ4

Protein Details
Accession A8PVZ4    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-30KVTTGTRRTKAKKDPAAPKRPLSHydrophilic
NLS Segment(s)
PositionSequence
15-26RTKAKKDPAAPK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG mgl:MGL_0991  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKQPTPKVTTGTRRTKAKKDPAAPKRPLSAYMFFSQDWRDASKPRTLTQDSVCDVGRLLGTKWKEMSDEEKKPYVEMASKDKERAESEKAAYANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.78
4 0.8
5 0.8
6 0.8
7 0.79
8 0.82
9 0.83
10 0.86
11 0.82
12 0.76
13 0.71
14 0.62
15 0.57
16 0.5
17 0.44
18 0.38
19 0.34
20 0.32
21 0.27
22 0.27
23 0.24
24 0.21
25 0.18
26 0.17
27 0.17
28 0.18
29 0.21
30 0.25
31 0.25
32 0.25
33 0.3
34 0.29
35 0.3
36 0.29
37 0.32
38 0.27
39 0.27
40 0.25
41 0.19
42 0.17
43 0.15
44 0.13
45 0.08
46 0.08
47 0.11
48 0.12
49 0.14
50 0.15
51 0.15
52 0.16
53 0.17
54 0.25
55 0.29
56 0.35
57 0.37
58 0.41
59 0.4
60 0.39
61 0.39
62 0.33
63 0.29
64 0.27
65 0.31
66 0.34
67 0.36
68 0.38
69 0.39
70 0.4
71 0.39
72 0.4
73 0.38
74 0.36
75 0.37
76 0.4
77 0.4