Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q6I7

Protein Details
Accession A8Q6I7   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
308-330GAGDYRRHSQRRRNRKSEADTTLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
KEGG mgl:MGL_2978  -  
Amino Acid Sequences MKSSIAFISSCAFLFILAVLIALVLQCTNPPRLEARHPSLPPVGVRKRDDQVNAVQYPAPAPTTETSQLPTNPLNRAQPAASMSSQTLSMDPFENDTTKQPFVQSSYGQLPQPTVDATAPILQPVAETGRYKKTRSRALPQPPVPSRSDHGSHQGYYANGTSAYNNASATGYSDVGNVYNQQGYGYGYGYGYGTGTGASTGYTHVPNYAYPYEGMYQDASSPFNAYEVSAPVRGQASYQSHGYVPLPVPSASQPYGNYQDPNTFNSVSPSQHWSSKYNDYSHHRPLARHASQASSGKNSHLSRVDSVGAGDYRRHSQRRRNRKSEADTTLEKSQPRKSFADTTGNKQAPTPYSYDPGFSVAPNETFAVNYSFNEDSHYPLRDEYKYSQPELLWNSDYTNKGHYNSYYDAYPNKYQHRYDPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.07
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.05
11 0.04
12 0.04
13 0.06
14 0.1
15 0.14
16 0.14
17 0.17
18 0.22
19 0.28
20 0.37
21 0.44
22 0.48
23 0.54
24 0.54
25 0.57
26 0.55
27 0.53
28 0.48
29 0.49
30 0.49
31 0.48
32 0.52
33 0.53
34 0.54
35 0.58
36 0.56
37 0.51
38 0.51
39 0.51
40 0.48
41 0.43
42 0.39
43 0.33
44 0.31
45 0.27
46 0.2
47 0.12
48 0.14
49 0.14
50 0.18
51 0.2
52 0.2
53 0.21
54 0.25
55 0.26
56 0.27
57 0.3
58 0.28
59 0.3
60 0.33
61 0.36
62 0.33
63 0.34
64 0.31
65 0.29
66 0.28
67 0.27
68 0.24
69 0.21
70 0.19
71 0.18
72 0.17
73 0.15
74 0.13
75 0.1
76 0.11
77 0.11
78 0.11
79 0.13
80 0.14
81 0.15
82 0.16
83 0.2
84 0.23
85 0.22
86 0.23
87 0.22
88 0.22
89 0.24
90 0.27
91 0.23
92 0.23
93 0.26
94 0.29
95 0.28
96 0.26
97 0.24
98 0.2
99 0.2
100 0.16
101 0.13
102 0.1
103 0.1
104 0.11
105 0.13
106 0.13
107 0.12
108 0.12
109 0.1
110 0.09
111 0.1
112 0.11
113 0.1
114 0.11
115 0.15
116 0.25
117 0.28
118 0.31
119 0.35
120 0.41
121 0.48
122 0.54
123 0.59
124 0.59
125 0.67
126 0.74
127 0.73
128 0.75
129 0.69
130 0.66
131 0.59
132 0.52
133 0.44
134 0.39
135 0.36
136 0.28
137 0.32
138 0.31
139 0.3
140 0.28
141 0.27
142 0.22
143 0.22
144 0.2
145 0.13
146 0.11
147 0.11
148 0.1
149 0.09
150 0.1
151 0.09
152 0.08
153 0.08
154 0.08
155 0.08
156 0.09
157 0.09
158 0.09
159 0.08
160 0.09
161 0.08
162 0.08
163 0.09
164 0.08
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.08
173 0.07
174 0.06
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.06
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.12
195 0.12
196 0.11
197 0.1
198 0.12
199 0.12
200 0.12
201 0.13
202 0.09
203 0.08
204 0.09
205 0.1
206 0.09
207 0.08
208 0.08
209 0.07
210 0.07
211 0.07
212 0.06
213 0.06
214 0.07
215 0.09
216 0.09
217 0.09
218 0.1
219 0.1
220 0.1
221 0.09
222 0.13
223 0.14
224 0.16
225 0.16
226 0.16
227 0.16
228 0.17
229 0.17
230 0.15
231 0.12
232 0.12
233 0.13
234 0.12
235 0.13
236 0.13
237 0.17
238 0.14
239 0.16
240 0.15
241 0.17
242 0.22
243 0.22
244 0.22
245 0.19
246 0.25
247 0.25
248 0.26
249 0.26
250 0.22
251 0.21
252 0.24
253 0.25
254 0.2
255 0.2
256 0.23
257 0.22
258 0.25
259 0.28
260 0.27
261 0.3
262 0.37
263 0.39
264 0.37
265 0.42
266 0.45
267 0.49
268 0.53
269 0.55
270 0.49
271 0.46
272 0.5
273 0.54
274 0.49
275 0.46
276 0.4
277 0.35
278 0.38
279 0.41
280 0.36
281 0.3
282 0.28
283 0.26
284 0.32
285 0.3
286 0.3
287 0.3
288 0.31
289 0.28
290 0.3
291 0.29
292 0.22
293 0.22
294 0.19
295 0.16
296 0.14
297 0.15
298 0.14
299 0.19
300 0.26
301 0.33
302 0.38
303 0.48
304 0.58
305 0.67
306 0.76
307 0.79
308 0.81
309 0.84
310 0.85
311 0.84
312 0.79
313 0.74
314 0.67
315 0.63
316 0.6
317 0.53
318 0.48
319 0.43
320 0.45
321 0.45
322 0.46
323 0.44
324 0.44
325 0.48
326 0.5
327 0.56
328 0.51
329 0.52
330 0.57
331 0.56
332 0.5
333 0.44
334 0.44
335 0.37
336 0.37
337 0.34
338 0.27
339 0.3
340 0.3
341 0.3
342 0.26
343 0.26
344 0.24
345 0.19
346 0.19
347 0.17
348 0.17
349 0.17
350 0.17
351 0.14
352 0.13
353 0.15
354 0.16
355 0.14
356 0.14
357 0.17
358 0.17
359 0.17
360 0.22
361 0.21
362 0.22
363 0.26
364 0.28
365 0.24
366 0.26
367 0.32
368 0.3
369 0.35
370 0.34
371 0.4
372 0.42
373 0.44
374 0.44
375 0.4
376 0.44
377 0.43
378 0.43
379 0.36
380 0.32
381 0.32
382 0.34
383 0.36
384 0.31
385 0.33
386 0.32
387 0.31
388 0.35
389 0.34
390 0.34
391 0.36
392 0.37
393 0.32
394 0.32
395 0.35
396 0.37
397 0.42
398 0.43
399 0.49
400 0.53
401 0.54