Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PSM0

Protein Details
Accession A8PSM0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
79-102KGDSCYRPRRTGQRRRKSVRGCIVHydrophilic
181-207QRLITPQRLQRKRDARRLKKEFIAKKHBasic
NLS Segment(s)
PositionSequence
166-209PKKEGAKPYTKAPRIQRLITPQRLQRKRDARRLKKEFIAKKHAQ
Subcellular Location(s) nucl 13.5, cyto_nucl 12.833, cyto 10, mito_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgl:MGL_0281  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNVANPATGAQKSFEFMDERPVRCFYDKRMSQDVEVDSLGDEWKGYVLRIGGGNDKQGFPMKQGVLLPSRVRLLLGKGDSCYRPRRTGQRRRKSVRGCIVGPDIQALHCIIVKQGEQDIPGLTDPESAVPKRLGPKRANHIRKFFNLTKEDDVRQYVIRREIQPKKEGAKPYTKAPRIQRLITPQRLQRKRDARRLKKEFIAKKHAQKAAYDALVAQRVAEKKQRLAHHKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.18
5 0.17
6 0.27
7 0.32
8 0.33
9 0.35
10 0.36
11 0.37
12 0.39
13 0.42
14 0.38
15 0.42
16 0.46
17 0.5
18 0.55
19 0.54
20 0.5
21 0.53
22 0.47
23 0.39
24 0.33
25 0.26
26 0.18
27 0.17
28 0.15
29 0.09
30 0.08
31 0.05
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.11
39 0.13
40 0.17
41 0.17
42 0.22
43 0.22
44 0.22
45 0.22
46 0.25
47 0.23
48 0.2
49 0.26
50 0.21
51 0.22
52 0.23
53 0.25
54 0.23
55 0.26
56 0.24
57 0.2
58 0.21
59 0.18
60 0.18
61 0.15
62 0.15
63 0.17
64 0.18
65 0.17
66 0.17
67 0.21
68 0.22
69 0.26
70 0.31
71 0.3
72 0.33
73 0.37
74 0.47
75 0.55
76 0.64
77 0.71
78 0.74
79 0.81
80 0.82
81 0.87
82 0.83
83 0.81
84 0.79
85 0.73
86 0.63
87 0.56
88 0.52
89 0.43
90 0.36
91 0.27
92 0.18
93 0.13
94 0.12
95 0.09
96 0.07
97 0.06
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.06
112 0.06
113 0.06
114 0.07
115 0.09
116 0.09
117 0.11
118 0.1
119 0.13
120 0.2
121 0.25
122 0.31
123 0.33
124 0.4
125 0.49
126 0.59
127 0.66
128 0.65
129 0.67
130 0.65
131 0.65
132 0.66
133 0.6
134 0.57
135 0.5
136 0.48
137 0.46
138 0.45
139 0.42
140 0.36
141 0.34
142 0.28
143 0.27
144 0.26
145 0.24
146 0.26
147 0.3
148 0.32
149 0.4
150 0.47
151 0.5
152 0.52
153 0.53
154 0.52
155 0.54
156 0.56
157 0.52
158 0.53
159 0.49
160 0.54
161 0.59
162 0.59
163 0.6
164 0.61
165 0.66
166 0.62
167 0.63
168 0.59
169 0.59
170 0.65
171 0.66
172 0.64
173 0.61
174 0.66
175 0.71
176 0.69
177 0.69
178 0.7
179 0.71
180 0.76
181 0.81
182 0.81
183 0.84
184 0.89
185 0.86
186 0.83
187 0.83
188 0.81
189 0.79
190 0.78
191 0.75
192 0.76
193 0.79
194 0.76
195 0.67
196 0.59
197 0.57
198 0.54
199 0.46
200 0.36
201 0.28
202 0.27
203 0.29
204 0.27
205 0.21
206 0.2
207 0.21
208 0.26
209 0.33
210 0.34
211 0.37
212 0.45
213 0.54