Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8QAC3

Protein Details
Accession A8QAC3   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-68AWTYQPARRKARPRSRRSKPLGTSHydrophilic
NLS Segment(s)
PositionSequence
51-63ARRKARPRSRRSK
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
KEGG mgl:MGL_3682  -  
Amino Acid Sequences MLAPYVRSYSIPTLPVTCTGALDGSVQVFFTELEGVQEPTSTTSAWTYQPARRKARPRSRRSKPLGTSSEPLSLTEEAFWTLPPAKAEYGPEVLTTPIPISPKLHGTDERIPQIDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.25
4 0.2
5 0.17
6 0.16
7 0.14
8 0.12
9 0.12
10 0.1
11 0.08
12 0.08
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.07
21 0.08
22 0.09
23 0.09
24 0.09
25 0.08
26 0.09
27 0.1
28 0.08
29 0.08
30 0.08
31 0.1
32 0.11
33 0.14
34 0.16
35 0.2
36 0.28
37 0.36
38 0.41
39 0.47
40 0.56
41 0.63
42 0.7
43 0.76
44 0.79
45 0.81
46 0.84
47 0.87
48 0.85
49 0.84
50 0.77
51 0.75
52 0.71
53 0.64
54 0.57
55 0.49
56 0.46
57 0.36
58 0.33
59 0.26
60 0.21
61 0.17
62 0.15
63 0.13
64 0.1
65 0.09
66 0.09
67 0.08
68 0.1
69 0.11
70 0.12
71 0.14
72 0.14
73 0.15
74 0.17
75 0.18
76 0.19
77 0.18
78 0.18
79 0.16
80 0.16
81 0.15
82 0.14
83 0.11
84 0.11
85 0.12
86 0.13
87 0.15
88 0.17
89 0.22
90 0.24
91 0.29
92 0.3
93 0.35
94 0.42
95 0.47
96 0.5