Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8Q958

Protein Details
Accession A8Q958    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-120LAAPKKKVSHSRKAMRAANKHydrophilic
NLS Segment(s)
PositionSequence
105-121KKKVSHSRKAMRAANKG
Subcellular Location(s) mito 14, cyto 8, plas 2, extr 2
Family & Domain DBs
KEGG mgl:MGL_3417  -  
Amino Acid Sequences MHAIVGILRVRTLVQAVVGSACAPTAPVTTALGLSAMPIWTTTSRIWTHCSDQLRSYFQDNVFDPPGSCTSRLSIAGNPSAASPSLPLADASPLLWDGLVLAAPKKKVSHSRKAMRAANKGLKDRVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.09
6 0.08
7 0.07
8 0.06
9 0.05
10 0.05
11 0.05
12 0.06
13 0.07
14 0.08
15 0.09
16 0.09
17 0.09
18 0.09
19 0.08
20 0.07
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.07
27 0.07
28 0.1
29 0.1
30 0.14
31 0.16
32 0.18
33 0.21
34 0.22
35 0.26
36 0.28
37 0.31
38 0.28
39 0.29
40 0.31
41 0.3
42 0.29
43 0.28
44 0.26
45 0.23
46 0.25
47 0.23
48 0.23
49 0.21
50 0.2
51 0.17
52 0.15
53 0.18
54 0.15
55 0.15
56 0.12
57 0.12
58 0.14
59 0.15
60 0.15
61 0.14
62 0.15
63 0.16
64 0.16
65 0.15
66 0.13
67 0.13
68 0.11
69 0.09
70 0.07
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.05
84 0.04
85 0.05
86 0.05
87 0.05
88 0.08
89 0.11
90 0.12
91 0.14
92 0.15
93 0.21
94 0.31
95 0.39
96 0.48
97 0.56
98 0.65
99 0.71
100 0.78
101 0.8
102 0.78
103 0.78
104 0.77
105 0.76
106 0.73
107 0.71
108 0.65