Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XT51

Protein Details
Accession G1XT51   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-108VMKAFGKKDLPKRDKKNLQKYCEQFKDHydrophilic
NLS Segment(s)
PositionSequence
87-96GKKDLPKRDK
Subcellular Location(s) cyto 12.5, cyto_mito 11.666, mito 9.5, cyto_nucl 8.833, nucl 3
Family & Domain DBs
Amino Acid Sequences MTDKSLTYHTLFLRKAADARFTDVSASRSLWWGKNVPATLHFLEAYPIVLTSVLSGVTKNIGEDAKTLVKKLHARSQATKGVMKAFGKKDLPKRDKKNLQKYCEQFKDAIPASADTVGHDMGLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.3
4 0.33
5 0.27
6 0.32
7 0.31
8 0.29
9 0.29
10 0.27
11 0.26
12 0.21
13 0.21
14 0.16
15 0.18
16 0.21
17 0.21
18 0.22
19 0.23
20 0.24
21 0.28
22 0.28
23 0.26
24 0.25
25 0.28
26 0.25
27 0.24
28 0.21
29 0.16
30 0.16
31 0.14
32 0.13
33 0.08
34 0.07
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.1
52 0.14
53 0.14
54 0.14
55 0.14
56 0.18
57 0.23
58 0.26
59 0.31
60 0.33
61 0.37
62 0.42
63 0.47
64 0.48
65 0.46
66 0.44
67 0.37
68 0.34
69 0.33
70 0.3
71 0.31
72 0.27
73 0.31
74 0.33
75 0.39
76 0.45
77 0.52
78 0.59
79 0.63
80 0.69
81 0.74
82 0.81
83 0.85
84 0.87
85 0.86
86 0.83
87 0.83
88 0.81
89 0.81
90 0.77
91 0.69
92 0.59
93 0.51
94 0.54
95 0.45
96 0.41
97 0.32
98 0.27
99 0.26
100 0.27
101 0.25
102 0.17
103 0.18
104 0.15
105 0.13