Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XT01

Protein Details
Accession G1XT01    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
146-168KPDLPGRFRRRNGEEKRDRRFNPBasic
NLS Segment(s)
PositionSequence
122-180AAAKTAPPGAKGIKPSALKLGGVAKPDLPGRFRRRNGEEKRDRRFNPESFPSRKSIKAA
Subcellular Location(s) extr 13, mito 3, plas 3, pero 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MQISRIIAVVLFMGSTTLAAPVAEPNPNPAVYNPWEHIRAGTKPVASSRKRQINYPKGTNLLPDIMRPTAGQEREDRRRVKREDPPAVAPVPAPVAAPPVAAPAEPVAEEVSAKKTASSFKAAAKTAPPGAKGIKPSALKLGGVAKPDLPGRFRRRNGEEKRDRRFNPESFPSRKSIKAAPSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.09
9 0.11
10 0.13
11 0.13
12 0.17
13 0.19
14 0.2
15 0.2
16 0.18
17 0.21
18 0.21
19 0.26
20 0.24
21 0.26
22 0.27
23 0.26
24 0.28
25 0.27
26 0.26
27 0.26
28 0.27
29 0.24
30 0.24
31 0.31
32 0.38
33 0.36
34 0.41
35 0.46
36 0.53
37 0.53
38 0.59
39 0.63
40 0.64
41 0.7
42 0.68
43 0.62
44 0.55
45 0.54
46 0.48
47 0.39
48 0.32
49 0.24
50 0.18
51 0.18
52 0.15
53 0.15
54 0.14
55 0.16
56 0.18
57 0.19
58 0.19
59 0.23
60 0.31
61 0.38
62 0.45
63 0.46
64 0.46
65 0.54
66 0.57
67 0.59
68 0.6
69 0.62
70 0.63
71 0.62
72 0.59
73 0.53
74 0.48
75 0.4
76 0.31
77 0.22
78 0.15
79 0.11
80 0.08
81 0.05
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.06
94 0.05
95 0.05
96 0.05
97 0.06
98 0.08
99 0.09
100 0.09
101 0.09
102 0.1
103 0.14
104 0.16
105 0.2
106 0.19
107 0.23
108 0.28
109 0.28
110 0.28
111 0.27
112 0.27
113 0.27
114 0.27
115 0.23
116 0.21
117 0.23
118 0.25
119 0.26
120 0.25
121 0.27
122 0.27
123 0.27
124 0.3
125 0.28
126 0.25
127 0.24
128 0.28
129 0.24
130 0.25
131 0.24
132 0.2
133 0.21
134 0.24
135 0.25
136 0.21
137 0.28
138 0.36
139 0.45
140 0.49
141 0.56
142 0.61
143 0.69
144 0.76
145 0.78
146 0.8
147 0.8
148 0.85
149 0.86
150 0.8
151 0.78
152 0.76
153 0.69
154 0.67
155 0.67
156 0.66
157 0.62
158 0.64
159 0.61
160 0.57
161 0.56
162 0.51
163 0.48
164 0.5