Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X388

Protein Details
Accession G1X388   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-79QQPYRIQKQRSKPGPKPKPKFIPSHydrophilic
NLS Segment(s)
PositionSequence
64-75QRSKPGPKPKPK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR031106  C/EBP  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MGLPLFPTPTSTSSASPTLGSVASGSPSTSSPSSSYLPHSLQSTPSLPPLPHHSQQQPYRIQKQRSKPGPKPKPKFIPSVSPTIAGEDDDSPEVIDKRFRNNLAAKKYRQKKVDRISELESALADMTRERDELRLLLARKEAEGQVLREVMAKSKGGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.2
5 0.18
6 0.15
7 0.14
8 0.11
9 0.09
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.13
16 0.12
17 0.14
18 0.14
19 0.17
20 0.19
21 0.19
22 0.23
23 0.24
24 0.25
25 0.25
26 0.25
27 0.23
28 0.23
29 0.25
30 0.22
31 0.19
32 0.2
33 0.21
34 0.19
35 0.2
36 0.26
37 0.29
38 0.3
39 0.35
40 0.37
41 0.43
42 0.48
43 0.54
44 0.54
45 0.54
46 0.61
47 0.63
48 0.66
49 0.66
50 0.7
51 0.73
52 0.74
53 0.77
54 0.76
55 0.79
56 0.82
57 0.85
58 0.83
59 0.82
60 0.82
61 0.75
62 0.74
63 0.65
64 0.64
65 0.55
66 0.55
67 0.46
68 0.37
69 0.34
70 0.28
71 0.26
72 0.16
73 0.14
74 0.08
75 0.08
76 0.08
77 0.08
78 0.06
79 0.07
80 0.08
81 0.07
82 0.12
83 0.12
84 0.18
85 0.23
86 0.23
87 0.29
88 0.35
89 0.42
90 0.47
91 0.53
92 0.53
93 0.58
94 0.67
95 0.68
96 0.69
97 0.69
98 0.7
99 0.72
100 0.77
101 0.72
102 0.68
103 0.65
104 0.61
105 0.54
106 0.44
107 0.33
108 0.23
109 0.18
110 0.13
111 0.09
112 0.06
113 0.08
114 0.09
115 0.1
116 0.1
117 0.11
118 0.13
119 0.13
120 0.16
121 0.2
122 0.21
123 0.23
124 0.25
125 0.25
126 0.24
127 0.27
128 0.24
129 0.24
130 0.26
131 0.25
132 0.25
133 0.25
134 0.24
135 0.25
136 0.25
137 0.22
138 0.23
139 0.22