Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XV51

Protein Details
Accession G1XV51   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-27MESQGRRKAPARKRKDDLLRDLFGHydrophilic
NLS Segment(s)
PositionSequence
9-18RRKAPARKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MHAMESQGRRKAPARKRKDDLLRDLFGEENPDLPSPQDRWINIQAVVREVYKELGREYGFIDKRWTEITPRWKIDLSNEVLSRLAEPDRRVLEYRPDVVERLLKDHVSNRGDWKKEKARKMVQQAERGSPPSERMSPQDTGSLSPYEERMEYEFATPRSGSHQSLQASLPPLSSFVEGVERMRGSRADTRQVYEETRAQKSAGFGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.7
3 0.75
4 0.81
5 0.85
6 0.84
7 0.83
8 0.8
9 0.72
10 0.63
11 0.58
12 0.49
13 0.39
14 0.34
15 0.23
16 0.17
17 0.16
18 0.16
19 0.15
20 0.15
21 0.18
22 0.16
23 0.22
24 0.25
25 0.24
26 0.3
27 0.34
28 0.36
29 0.35
30 0.36
31 0.3
32 0.28
33 0.29
34 0.23
35 0.18
36 0.16
37 0.16
38 0.14
39 0.14
40 0.13
41 0.16
42 0.16
43 0.16
44 0.17
45 0.24
46 0.24
47 0.24
48 0.27
49 0.23
50 0.24
51 0.25
52 0.24
53 0.19
54 0.25
55 0.34
56 0.38
57 0.4
58 0.41
59 0.4
60 0.39
61 0.39
62 0.39
63 0.33
64 0.3
65 0.28
66 0.27
67 0.26
68 0.25
69 0.22
70 0.16
71 0.14
72 0.12
73 0.12
74 0.16
75 0.17
76 0.19
77 0.2
78 0.2
79 0.25
80 0.25
81 0.27
82 0.24
83 0.23
84 0.22
85 0.21
86 0.23
87 0.16
88 0.17
89 0.15
90 0.14
91 0.14
92 0.17
93 0.22
94 0.21
95 0.21
96 0.26
97 0.31
98 0.33
99 0.34
100 0.39
101 0.42
102 0.49
103 0.54
104 0.56
105 0.58
106 0.63
107 0.71
108 0.73
109 0.69
110 0.69
111 0.65
112 0.6
113 0.54
114 0.48
115 0.4
116 0.31
117 0.27
118 0.23
119 0.23
120 0.2
121 0.22
122 0.24
123 0.25
124 0.25
125 0.25
126 0.22
127 0.21
128 0.22
129 0.19
130 0.15
131 0.15
132 0.15
133 0.12
134 0.12
135 0.12
136 0.12
137 0.13
138 0.14
139 0.16
140 0.19
141 0.18
142 0.21
143 0.19
144 0.17
145 0.21
146 0.24
147 0.23
148 0.22
149 0.27
150 0.26
151 0.29
152 0.29
153 0.26
154 0.26
155 0.24
156 0.22
157 0.17
158 0.17
159 0.16
160 0.16
161 0.12
162 0.1
163 0.13
164 0.13
165 0.14
166 0.18
167 0.17
168 0.17
169 0.19
170 0.19
171 0.2
172 0.28
173 0.32
174 0.37
175 0.39
176 0.42
177 0.45
178 0.47
179 0.46
180 0.42
181 0.44
182 0.4
183 0.42
184 0.39
185 0.35
186 0.34