Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XTN5

Protein Details
Accession G1XTN5    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-48GVYQERPLNRPKKQRNPEEEEEDEAcidic
137-168AKKADRKDKGDEAPKKKKPRPKQKVKLSFGDDBasic
NLS Segment(s)
PositionSequence
137-162AKKADRKDKGDEAPKKKKPRPKQKVK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAHKNLSYESKEPAFLQRLRAQTAGVYQERPLNRPKKQRNPEEEEEDEPVYVLEDNTTLSGKEFDALKEETAAKAKSSEEEEGQEADPDKLSKGDLEDKSKRTKNEKSKDSVLEIGVKTQKRKIAKVVGAEASDDEAKKADRKDKGDEAPKKKKPRPKQKVKLSFGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.4
4 0.4
5 0.42
6 0.43
7 0.42
8 0.36
9 0.3
10 0.32
11 0.32
12 0.27
13 0.25
14 0.23
15 0.28
16 0.3
17 0.31
18 0.36
19 0.38
20 0.44
21 0.54
22 0.64
23 0.69
24 0.77
25 0.85
26 0.85
27 0.85
28 0.84
29 0.81
30 0.73
31 0.64
32 0.57
33 0.47
34 0.38
35 0.28
36 0.21
37 0.14
38 0.11
39 0.08
40 0.05
41 0.04
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.09
51 0.08
52 0.12
53 0.12
54 0.12
55 0.13
56 0.13
57 0.12
58 0.15
59 0.15
60 0.11
61 0.12
62 0.12
63 0.12
64 0.14
65 0.14
66 0.12
67 0.13
68 0.14
69 0.14
70 0.14
71 0.13
72 0.11
73 0.1
74 0.09
75 0.08
76 0.08
77 0.06
78 0.07
79 0.06
80 0.08
81 0.15
82 0.18
83 0.25
84 0.3
85 0.33
86 0.41
87 0.45
88 0.48
89 0.48
90 0.54
91 0.58
92 0.62
93 0.66
94 0.64
95 0.67
96 0.65
97 0.6
98 0.53
99 0.43
100 0.39
101 0.32
102 0.3
103 0.3
104 0.29
105 0.28
106 0.3
107 0.34
108 0.33
109 0.36
110 0.39
111 0.43
112 0.45
113 0.47
114 0.49
115 0.46
116 0.42
117 0.39
118 0.32
119 0.25
120 0.22
121 0.17
122 0.13
123 0.11
124 0.12
125 0.17
126 0.22
127 0.27
128 0.33
129 0.37
130 0.45
131 0.52
132 0.59
133 0.65
134 0.7
135 0.73
136 0.77
137 0.82
138 0.85
139 0.85
140 0.86
141 0.87
142 0.89
143 0.9
144 0.9
145 0.92
146 0.92
147 0.95
148 0.92