Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5A5Q6

Protein Details
Accession Q5A5Q6   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
387-414LCNSCGLRYKKTKARCLNDKCKKIPAKGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0009267  P:cellular response to starvation  
GO:0006325  P:chromatin organization  
GO:0030447  P:filamentous growth  
GO:0044182  P:filamentous growth of a population of unicellular organisms  
GO:0036180  P:filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0036178  P:filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:0036170  P:filamentous growth of a population of unicellular organisms in response to starvation  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:1900430  P:positive regulation of filamentous growth of a population of unicellular organisms  
GO:1900445  P:positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:1900442  P:positive regulation of filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:1900436  P:positive regulation of filamentous growth of a population of unicellular organisms in response to starvation  
GO:0036176  P:response to neutral pH  
KEGG cal:CAALFM_C210660WA  -  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MSLVQSAMFNHHMGPSHTRSRSFELFQEAKTLRVAACKRSYSDDLNISTKRARTAPPSPPYETATPTRASRLVISNLVKPTSNLRSRSLSPNKKFSSPLSPSSSPIATVTSPISSPQNIKIKLPSISDALNLPPITSKEPVKLKPIVPTVSLDYFDTYKPNDENWRYGLLDKIAKESKHFHLNQYNYLNDHAKPSFDSKLSSKIQQSSIANGKKINFPYESNYTYLNKTYLNDVKNYPEYLELAAESLLQLKERQLPPPPLQSHQKQHPPPPPHLPVQGLLPVPAPPVSHFSSSYTTPQAPTFYHPPSQQQQQTPPPQTLHHQQPQPPISTHKFIPISPPSAKKSRSDLLKSPPKHHHHHAPRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLRYKKTKARCLNDKCKKIPAKGEWTLMQSKGKETFEDGIEGYSCIACGWRVEVLPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.39
4 0.43
5 0.46
6 0.48
7 0.53
8 0.56
9 0.52
10 0.49
11 0.49
12 0.48
13 0.44
14 0.48
15 0.41
16 0.36
17 0.34
18 0.32
19 0.23
20 0.29
21 0.32
22 0.32
23 0.39
24 0.41
25 0.42
26 0.48
27 0.52
28 0.48
29 0.51
30 0.49
31 0.46
32 0.49
33 0.47
34 0.43
35 0.43
36 0.4
37 0.37
38 0.34
39 0.34
40 0.36
41 0.43
42 0.5
43 0.54
44 0.58
45 0.59
46 0.58
47 0.58
48 0.53
49 0.49
50 0.43
51 0.39
52 0.36
53 0.33
54 0.34
55 0.31
56 0.29
57 0.29
58 0.3
59 0.3
60 0.33
61 0.35
62 0.36
63 0.37
64 0.37
65 0.34
66 0.29
67 0.32
68 0.34
69 0.39
70 0.37
71 0.38
72 0.42
73 0.46
74 0.56
75 0.6
76 0.61
77 0.61
78 0.68
79 0.67
80 0.65
81 0.64
82 0.57
83 0.56
84 0.51
85 0.51
86 0.49
87 0.47
88 0.46
89 0.47
90 0.43
91 0.33
92 0.28
93 0.24
94 0.16
95 0.16
96 0.15
97 0.12
98 0.12
99 0.13
100 0.15
101 0.15
102 0.17
103 0.23
104 0.31
105 0.31
106 0.32
107 0.35
108 0.36
109 0.37
110 0.37
111 0.31
112 0.24
113 0.24
114 0.23
115 0.2
116 0.17
117 0.18
118 0.16
119 0.14
120 0.14
121 0.15
122 0.17
123 0.18
124 0.19
125 0.22
126 0.29
127 0.31
128 0.35
129 0.38
130 0.37
131 0.41
132 0.45
133 0.4
134 0.34
135 0.34
136 0.32
137 0.28
138 0.27
139 0.21
140 0.17
141 0.17
142 0.16
143 0.16
144 0.13
145 0.14
146 0.14
147 0.17
148 0.24
149 0.25
150 0.27
151 0.28
152 0.3
153 0.28
154 0.27
155 0.27
156 0.21
157 0.22
158 0.2
159 0.23
160 0.24
161 0.23
162 0.25
163 0.28
164 0.29
165 0.35
166 0.35
167 0.35
168 0.39
169 0.41
170 0.46
171 0.44
172 0.41
173 0.33
174 0.34
175 0.31
176 0.23
177 0.25
178 0.19
179 0.16
180 0.17
181 0.19
182 0.19
183 0.18
184 0.2
185 0.17
186 0.25
187 0.26
188 0.28
189 0.28
190 0.29
191 0.3
192 0.33
193 0.32
194 0.29
195 0.35
196 0.33
197 0.31
198 0.29
199 0.29
200 0.29
201 0.29
202 0.27
203 0.21
204 0.2
205 0.24
206 0.27
207 0.27
208 0.23
209 0.24
210 0.23
211 0.22
212 0.22
213 0.18
214 0.14
215 0.13
216 0.17
217 0.2
218 0.2
219 0.21
220 0.21
221 0.24
222 0.25
223 0.24
224 0.2
225 0.15
226 0.15
227 0.13
228 0.12
229 0.08
230 0.07
231 0.06
232 0.06
233 0.05
234 0.06
235 0.06
236 0.06
237 0.07
238 0.08
239 0.15
240 0.17
241 0.19
242 0.23
243 0.28
244 0.31
245 0.4
246 0.41
247 0.38
248 0.43
249 0.47
250 0.48
251 0.51
252 0.57
253 0.52
254 0.59
255 0.63
256 0.61
257 0.6
258 0.61
259 0.58
260 0.52
261 0.5
262 0.43
263 0.35
264 0.32
265 0.31
266 0.23
267 0.19
268 0.16
269 0.14
270 0.13
271 0.13
272 0.11
273 0.08
274 0.13
275 0.14
276 0.16
277 0.16
278 0.18
279 0.2
280 0.22
281 0.24
282 0.22
283 0.21
284 0.2
285 0.21
286 0.2
287 0.19
288 0.22
289 0.25
290 0.24
291 0.28
292 0.28
293 0.33
294 0.36
295 0.43
296 0.44
297 0.43
298 0.48
299 0.52
300 0.6
301 0.57
302 0.55
303 0.49
304 0.45
305 0.45
306 0.45
307 0.46
308 0.44
309 0.47
310 0.48
311 0.55
312 0.57
313 0.55
314 0.49
315 0.47
316 0.44
317 0.43
318 0.39
319 0.37
320 0.36
321 0.32
322 0.38
323 0.36
324 0.37
325 0.38
326 0.43
327 0.41
328 0.46
329 0.49
330 0.44
331 0.47
332 0.48
333 0.51
334 0.52
335 0.54
336 0.57
337 0.65
338 0.65
339 0.66
340 0.69
341 0.67
342 0.67
343 0.68
344 0.69
345 0.69
346 0.76
347 0.75
348 0.74
349 0.74
350 0.71
351 0.64
352 0.55
353 0.48
354 0.42
355 0.39
356 0.34
357 0.29
358 0.26
359 0.32
360 0.38
361 0.36
362 0.32
363 0.31
364 0.32
365 0.39
366 0.49
367 0.51
368 0.52
369 0.57
370 0.64
371 0.67
372 0.72
373 0.68
374 0.59
375 0.55
376 0.48
377 0.43
378 0.43
379 0.43
380 0.44
381 0.48
382 0.55
383 0.58
384 0.66
385 0.75
386 0.77
387 0.82
388 0.83
389 0.85
390 0.87
391 0.9
392 0.9
393 0.84
394 0.84
395 0.82
396 0.78
397 0.77
398 0.75
399 0.74
400 0.71
401 0.72
402 0.65
403 0.63
404 0.6
405 0.54
406 0.51
407 0.42
408 0.41
409 0.42
410 0.4
411 0.35
412 0.35
413 0.36
414 0.31
415 0.33
416 0.28
417 0.23
418 0.22
419 0.21
420 0.18
421 0.13
422 0.12
423 0.09
424 0.09
425 0.08
426 0.08
427 0.11
428 0.13
429 0.14