FuNGI

Q5A5Q6

Protein Details

Accession

Q5A5Q6

Localization Confidence

Low

Confidence Score

8.9

NoLS Segment(s)

Position	Sequence	Protein Nature
387-414	LCNSCGLRYKKTKARCLNDKCKKIPAKG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 15.5, cyto_nucl 12.5, mito 7, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR000679 Znf_GATA IPR013088 Znf_NHR/GATA
Gene Ontology	GO:0005634 C:nucleus GO:0003700 F:DNA-binding transcription factor activity GO:0043565 F:sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0009267 P:cellular response to starvation GO:0006325 P:chromatin organization GO:0030447 P:filamentous growth GO:0044182 P:filamentous growth of a population of unicellular organisms GO:0036180 P:filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:0036178 P:filamentous growth of a population of unicellular organisms in response to neutral pH GO:0036170 P:filamentous growth of a population of unicellular organisms in response to starvation GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:1900430 P:positive regulation of filamentous growth of a population of unicellular organisms GO:1900445 P:positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:1900442 P:positive regulation of filamentous growth of a population of unicellular organisms in response to neutral pH GO:1900436 P:positive regulation of filamentous growth of a population of unicellular organisms in response to starvation GO:0036176 P:response to neutral pH
KEGG	cal:CAALFM_C210660WA -
Pfam	View protein in Pfam PF00320 GATA
PROSITE	View protein in PROSITE PS50114 GATA_ZN_FINGER_2
CDD	cd00202 ZnF_GATA

Amino Acid Sequences

MSLVQSAMFNHHMGPSHTRSRSFELFQEAKTLRVAACKRSYSDDLNISTKRARTAPPSPPYETATPTRASRLVISNLVKPTSNLRSRSLSPNKKFSSPLSPSSSPIATVTSPISSPQNIKIKLPSISDALNLPPITSKEPVKLKPIVPTVSLDYFDTYKPNDENWRYGLLDKIAKESKHFHLNQYNYLNDHAKPSFDSKLSSKIQQSSIANGKKINFPYESNYTYLNKTYLNDVKNYPEYLELAAESLLQLKERQLPPPPLQSHQKQHPPPPPHLPVQGLLPVPAPPVSHFSSSYTTPQAPTFYHPPSQQQQQTPPPQTLHHQQPQPPISTHKFIPISPPSAKKSRSDLLKSPPKHHHHHAPRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLRYKKTKARCLNDKCKKIPAKGEWTLMQSKGKETFEDGIEGYSCIACGWRVEVLPKS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.32
3	0.39
4	0.43
5	0.46
6	0.48
7	0.53
8	0.56
9	0.52
10	0.49
11	0.49
12	0.48
13	0.44
14	0.48
15	0.41
16	0.36
17	0.34
18	0.32
19	0.23
20	0.29
21	0.32
22	0.32
23	0.39
24	0.41
25	0.42
26	0.48
27	0.52
28	0.48
29	0.51
30	0.49
31	0.46
32	0.49
33	0.47
34	0.43
35	0.43
36	0.4
37	0.37
38	0.34
39	0.34
40	0.36
41	0.43
42	0.5
43	0.54
44	0.58
45	0.59
46	0.58
47	0.58
48	0.53
49	0.49
50	0.43
51	0.39
52	0.36
53	0.33
54	0.34
55	0.31
56	0.29
57	0.29
58	0.3
59	0.3
60	0.33
61	0.35
62	0.36
63	0.37
64	0.37
65	0.34
66	0.29
67	0.32
68	0.34
69	0.39
70	0.37
71	0.38
72	0.42
73	0.46
74	0.56
75	0.6
76	0.61
77	0.61
78	0.68
79	0.67
80	0.65
81	0.64
82	0.57
83	0.56
84	0.51
85	0.51
86	0.49
87	0.47
88	0.46
89	0.47
90	0.43
91	0.33
92	0.28
93	0.24
94	0.16
95	0.16
96	0.15
97	0.12
98	0.12
99	0.13
100	0.15
101	0.15
102	0.17
103	0.23
104	0.31
105	0.31
106	0.32
107	0.35
108	0.36
109	0.37
110	0.37
111	0.31
112	0.24
113	0.24
114	0.23
115	0.2
116	0.17
117	0.18
118	0.16
119	0.14
120	0.14
121	0.15
122	0.17
123	0.18
124	0.19
125	0.22
126	0.29
127	0.31
128	0.35
129	0.38
130	0.37
131	0.41
132	0.45
133	0.4
134	0.34
135	0.34
136	0.32
137	0.28
138	0.27
139	0.21
140	0.17
141	0.17
142	0.16
143	0.16
144	0.13
145	0.14
146	0.14
147	0.17
148	0.24
149	0.25
150	0.27
151	0.28
152	0.3
153	0.28
154	0.27
155	0.27
156	0.21
157	0.22
158	0.2
159	0.23
160	0.24
161	0.23
162	0.25
163	0.28
164	0.29
165	0.35
166	0.35
167	0.35
168	0.39
169	0.41
170	0.46
171	0.44
172	0.41
173	0.33
174	0.34
175	0.31
176	0.23
177	0.25
178	0.19
179	0.16
180	0.17
181	0.19
182	0.19
183	0.18
184	0.2
185	0.17
186	0.25
187	0.26
188	0.28
189	0.28
190	0.29
191	0.3
192	0.33
193	0.32
194	0.29
195	0.35
196	0.33
197	0.31
198	0.29
199	0.29
200	0.29
201	0.29
202	0.27
203	0.21
204	0.2
205	0.24
206	0.27
207	0.27
208	0.23
209	0.24
210	0.23
211	0.22
212	0.22
213	0.18
214	0.14
215	0.13
216	0.17
217	0.2
218	0.2
219	0.21
220	0.21
221	0.24
222	0.25
223	0.24
224	0.2
225	0.15
226	0.15
227	0.13
228	0.12
229	0.08
230	0.07
231	0.06
232	0.06
233	0.05
234	0.06
235	0.06
236	0.06
237	0.07
238	0.08
239	0.15
240	0.17
241	0.19
242	0.23
243	0.28
244	0.31
245	0.4
246	0.41
247	0.38
248	0.43
249	0.47
250	0.48
251	0.51
252	0.57
253	0.52
254	0.59
255	0.63
256	0.61
257	0.6
258	0.61
259	0.58
260	0.52
261	0.5
262	0.43
263	0.35
264	0.32
265	0.31
266	0.23
267	0.19
268	0.16
269	0.14
270	0.13
271	0.13
272	0.11
273	0.08
274	0.13
275	0.14
276	0.16
277	0.16
278	0.18
279	0.2
280	0.22
281	0.24
282	0.22
283	0.21
284	0.2
285	0.21
286	0.2
287	0.19
288	0.22
289	0.25
290	0.24
291	0.28
292	0.28
293	0.33
294	0.36
295	0.43
296	0.44
297	0.43
298	0.48
299	0.52
300	0.6
301	0.57
302	0.55
303	0.49
304	0.45
305	0.45
306	0.45
307	0.46
308	0.44
309	0.47
310	0.48
311	0.55
312	0.57
313	0.55
314	0.49
315	0.47
316	0.44
317	0.43
318	0.39
319	0.37
320	0.36
321	0.32
322	0.38
323	0.36
324	0.37
325	0.38
326	0.43
327	0.41
328	0.46
329	0.49
330	0.44
331	0.47
332	0.48
333	0.51
334	0.52
335	0.54
336	0.57
337	0.65
338	0.65
339	0.66
340	0.69
341	0.67
342	0.67
343	0.68
344	0.69
345	0.69
346	0.76
347	0.75
348	0.74
349	0.74
350	0.71
351	0.64
352	0.55
353	0.48
354	0.42
355	0.39
356	0.34
357	0.29
358	0.26
359	0.32
360	0.38
361	0.36
362	0.32
363	0.31
364	0.32
365	0.39
366	0.49
367	0.51
368	0.52
369	0.57
370	0.64
371	0.67
372	0.72
373	0.68
374	0.59
375	0.55
376	0.48
377	0.43
378	0.43
379	0.43
380	0.44
381	0.48
382	0.55
383	0.58
384	0.66
385	0.75
386	0.77
387	0.82
388	0.83
389	0.85
390	0.87
391	0.9
392	0.9
393	0.84
394	0.84
395	0.82
396	0.78
397	0.77
398	0.75
399	0.74
400	0.71
401	0.72
402	0.65
403	0.63
404	0.6
405	0.54
406	0.51
407	0.42
408	0.41
409	0.42
410	0.4
411	0.35
412	0.35
413	0.36
414	0.31
415	0.33
416	0.28
417	0.23
418	0.22
419	0.21
420	0.18
421	0.13
422	0.12
423	0.09
424	0.09
425	0.08
426	0.08
427	0.11
428	0.13
429	0.14

Q5A5Q6

3D AlphaFold-predicted Structure Viewer