Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X531

Protein Details
Accession G1X531   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
10-36VQESYRRRAAQHQKKKDDKAKVKEWLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MTFPNPFSAVQESYRRRAAQHQKKKDDKAKVKEWLEFTAQHRHEQWVDEELEPYLLTGTLHLVDTDASDEDANERQRGLESPPESPRLSDSAQPPLKAIKFVKYGRQFDTLGNSDTDIFFSRARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.41
4 0.49
5 0.56
6 0.57
7 0.63
8 0.69
9 0.74
10 0.82
11 0.9
12 0.88
13 0.88
14 0.86
15 0.84
16 0.82
17 0.81
18 0.75
19 0.7
20 0.64
21 0.56
22 0.49
23 0.44
24 0.39
25 0.4
26 0.37
27 0.35
28 0.34
29 0.33
30 0.31
31 0.29
32 0.27
33 0.21
34 0.22
35 0.19
36 0.18
37 0.15
38 0.14
39 0.12
40 0.11
41 0.07
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.1
59 0.11
60 0.1
61 0.1
62 0.1
63 0.11
64 0.13
65 0.14
66 0.17
67 0.18
68 0.22
69 0.25
70 0.29
71 0.28
72 0.28
73 0.27
74 0.24
75 0.24
76 0.24
77 0.24
78 0.3
79 0.33
80 0.32
81 0.32
82 0.33
83 0.33
84 0.34
85 0.32
86 0.29
87 0.34
88 0.36
89 0.45
90 0.49
91 0.52
92 0.51
93 0.54
94 0.49
95 0.43
96 0.48
97 0.41
98 0.34
99 0.3
100 0.27
101 0.23
102 0.22
103 0.23
104 0.18
105 0.17