Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XPD8

Protein Details
Accession G1XPD8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTTTLSVYRHPPRRRPRKTWLQRRFLLFEHydrophilic
NLS Segment(s)
PositionSequence
12-18PRRRPRK
Subcellular Location(s) mito 13, plas 7, cyto 3, vacu 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024512  Ser_palmitoyltrfase_ssu-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF11779  SPT_ssu-like  
Amino Acid Sequences MTTTLSVYRHPPRRRPRKTWLQRRFLLFEVTFGLYMMSTAEKLAFYTFLFLFLGFLTAAVTLYLPQHLQTVARRLLFYIFGDRGVIRNQDVLEYSSVFTEGVGVSRNAAMDTPPGFSIGRGEAMTSMGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.87
5 0.9
6 0.92
7 0.91
8 0.89
9 0.85
10 0.82
11 0.76
12 0.66
13 0.62
14 0.5
15 0.41
16 0.34
17 0.29
18 0.23
19 0.18
20 0.17
21 0.09
22 0.09
23 0.08
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.09
34 0.08
35 0.09
36 0.09
37 0.09
38 0.08
39 0.07
40 0.08
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.07
56 0.09
57 0.14
58 0.16
59 0.17
60 0.17
61 0.17
62 0.17
63 0.17
64 0.16
65 0.15
66 0.13
67 0.12
68 0.13
69 0.12
70 0.13
71 0.14
72 0.14
73 0.11
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.12
80 0.12
81 0.12
82 0.1
83 0.1
84 0.09
85 0.08
86 0.07
87 0.06
88 0.06
89 0.07
90 0.07
91 0.08
92 0.09
93 0.09
94 0.08
95 0.09
96 0.08
97 0.1
98 0.12
99 0.13
100 0.12
101 0.14
102 0.14
103 0.14
104 0.16
105 0.14
106 0.16
107 0.14
108 0.15
109 0.13