Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XDV2

Protein Details
Accession G1XDV2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33KNNINRPSASKPKARPKTKPSHTLRRISKTHydrophilic
NLS Segment(s)
PositionSequence
11-29SASKPKARPKTKPSHTLRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MANKNNINRPSASKPKARPKTKPSHTLRRISKTNSTANHQLSSKKSRKLLRNKAYTATRIIEEVGKEGGDVLMRALADETLSRKKEKMLKNLAANQEVKEQKEAVMDVDVDEAVAEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.78
4 0.8
5 0.81
6 0.8
7 0.85
8 0.85
9 0.86
10 0.84
11 0.85
12 0.84
13 0.84
14 0.82
15 0.79
16 0.77
17 0.72
18 0.71
19 0.65
20 0.64
21 0.58
22 0.55
23 0.54
24 0.5
25 0.48
26 0.41
27 0.39
28 0.38
29 0.45
30 0.45
31 0.43
32 0.47
33 0.51
34 0.59
35 0.66
36 0.71
37 0.71
38 0.73
39 0.7
40 0.69
41 0.65
42 0.57
43 0.49
44 0.39
45 0.3
46 0.22
47 0.2
48 0.15
49 0.12
50 0.12
51 0.09
52 0.07
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.04
59 0.05
60 0.04
61 0.05
62 0.05
63 0.04
64 0.05
65 0.06
66 0.09
67 0.15
68 0.17
69 0.18
70 0.19
71 0.25
72 0.33
73 0.4
74 0.47
75 0.5
76 0.56
77 0.62
78 0.69
79 0.68
80 0.65
81 0.58
82 0.5
83 0.48
84 0.44
85 0.38
86 0.34
87 0.29
88 0.25
89 0.27
90 0.25
91 0.18
92 0.17
93 0.15
94 0.13
95 0.14
96 0.12
97 0.09
98 0.09