Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XI01

Protein Details
Accession G1XI01    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
123-144GPCPRLPPRLRRRNGRNPLRPVBasic
NLS Segment(s)
PositionSequence
133-135RRR
Subcellular Location(s) nucl 15, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MKGERDVRLSVPSRLIPLLKDMTRIPILRPASHEICKLKGFWLTELLYSTWAQGTPRSGEKVSKVYSKQIRLCFHYRYKPAADEEDSAPEWRLFTPPCPPNSPPHSPPPPPPPPLRSAPIDLGPCPRLPPRLRRRNGRNPLRPVLAPTIVPAAIQLIPQPPLSAPPLSSPPLAIPRLGSCHSLRYSIPSPTSMATSVDPAITTGAKASQFPALLSSPCRTSTPSPNRNGPSEVPKTAHVTEVKARRRCQCLSTQPSTTESFSLLPNVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.26
4 0.29
5 0.32
6 0.28
7 0.3
8 0.28
9 0.31
10 0.35
11 0.35
12 0.31
13 0.32
14 0.34
15 0.34
16 0.38
17 0.39
18 0.4
19 0.42
20 0.46
21 0.41
22 0.42
23 0.41
24 0.37
25 0.32
26 0.31
27 0.3
28 0.25
29 0.28
30 0.25
31 0.24
32 0.25
33 0.23
34 0.2
35 0.19
36 0.18
37 0.13
38 0.13
39 0.12
40 0.12
41 0.15
42 0.17
43 0.2
44 0.23
45 0.23
46 0.26
47 0.29
48 0.33
49 0.34
50 0.37
51 0.36
52 0.41
53 0.47
54 0.52
55 0.55
56 0.56
57 0.57
58 0.56
59 0.6
60 0.58
61 0.58
62 0.59
63 0.56
64 0.53
65 0.52
66 0.49
67 0.47
68 0.44
69 0.39
70 0.33
71 0.31
72 0.29
73 0.27
74 0.24
75 0.22
76 0.18
77 0.15
78 0.13
79 0.15
80 0.12
81 0.13
82 0.21
83 0.25
84 0.28
85 0.32
86 0.33
87 0.38
88 0.44
89 0.49
90 0.44
91 0.48
92 0.52
93 0.49
94 0.53
95 0.55
96 0.55
97 0.52
98 0.53
99 0.48
100 0.45
101 0.46
102 0.44
103 0.37
104 0.33
105 0.31
106 0.31
107 0.28
108 0.24
109 0.24
110 0.21
111 0.19
112 0.18
113 0.18
114 0.21
115 0.23
116 0.33
117 0.41
118 0.5
119 0.56
120 0.64
121 0.72
122 0.76
123 0.83
124 0.83
125 0.81
126 0.78
127 0.76
128 0.69
129 0.59
130 0.51
131 0.44
132 0.34
133 0.25
134 0.19
135 0.16
136 0.13
137 0.13
138 0.1
139 0.08
140 0.07
141 0.07
142 0.08
143 0.07
144 0.09
145 0.09
146 0.1
147 0.08
148 0.1
149 0.12
150 0.11
151 0.11
152 0.11
153 0.15
154 0.16
155 0.17
156 0.15
157 0.15
158 0.2
159 0.2
160 0.18
161 0.15
162 0.15
163 0.19
164 0.2
165 0.21
166 0.17
167 0.21
168 0.22
169 0.23
170 0.22
171 0.25
172 0.26
173 0.27
174 0.27
175 0.23
176 0.24
177 0.22
178 0.24
179 0.18
180 0.16
181 0.13
182 0.14
183 0.13
184 0.12
185 0.11
186 0.1
187 0.1
188 0.09
189 0.08
190 0.07
191 0.09
192 0.1
193 0.1
194 0.11
195 0.13
196 0.13
197 0.13
198 0.16
199 0.15
200 0.16
201 0.18
202 0.19
203 0.18
204 0.19
205 0.21
206 0.22
207 0.26
208 0.35
209 0.44
210 0.5
211 0.54
212 0.61
213 0.64
214 0.63
215 0.63
216 0.56
217 0.54
218 0.52
219 0.49
220 0.43
221 0.42
222 0.43
223 0.4
224 0.41
225 0.33
226 0.32
227 0.36
228 0.44
229 0.5
230 0.52
231 0.58
232 0.6
233 0.65
234 0.64
235 0.62
236 0.63
237 0.64
238 0.66
239 0.67
240 0.63
241 0.59
242 0.59
243 0.57
244 0.48
245 0.38
246 0.31
247 0.26
248 0.22