Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GS51

Protein Details
Accession Q2GS51    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100GASSAYCRRRRIPRLRRIVGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MEAEREAGVDRMKDHYNRTTDSNRDRQAHHAPCAPITSCCIAGAAAITATGSPAVPRQRSRAGTATAGSGPAPSPGIATVGASSAYCRRRRIPRLRRIVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.36
4 0.37
5 0.42
6 0.44
7 0.48
8 0.53
9 0.57
10 0.57
11 0.56
12 0.55
13 0.56
14 0.59
15 0.56
16 0.52
17 0.48
18 0.42
19 0.39
20 0.4
21 0.34
22 0.25
23 0.22
24 0.2
25 0.14
26 0.13
27 0.13
28 0.1
29 0.09
30 0.08
31 0.06
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.07
41 0.11
42 0.14
43 0.16
44 0.21
45 0.27
46 0.29
47 0.34
48 0.34
49 0.33
50 0.32
51 0.31
52 0.28
53 0.22
54 0.2
55 0.16
56 0.12
57 0.09
58 0.08
59 0.08
60 0.06
61 0.07
62 0.07
63 0.08
64 0.07
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.09
71 0.14
72 0.22
73 0.26
74 0.3
75 0.38
76 0.48
77 0.59
78 0.69
79 0.73
80 0.76