Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XQR8

Protein Details
Accession G1XQR8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40NPTKPCKSSTTKKPSRCTTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 12
Family & Domain DBs
Amino Acid Sequences MQLLSTLALLTLASTAFSLPNPTKPCKSSTTKKPSRCTTTYTVTTSYPPRGVKYTTTVYTELIAVPRDLPCNGCTLKIVTKTINSSRKPDATVTATTAGLLQPPICFDFPTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.12
6 0.13
7 0.21
8 0.25
9 0.3
10 0.35
11 0.36
12 0.4
13 0.42
14 0.49
15 0.51
16 0.57
17 0.63
18 0.68
19 0.74
20 0.79
21 0.8
22 0.8
23 0.73
24 0.68
25 0.62
26 0.59
27 0.55
28 0.49
29 0.42
30 0.35
31 0.35
32 0.32
33 0.28
34 0.26
35 0.23
36 0.22
37 0.22
38 0.23
39 0.22
40 0.23
41 0.25
42 0.22
43 0.24
44 0.23
45 0.21
46 0.2
47 0.18
48 0.14
49 0.11
50 0.1
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.1
58 0.14
59 0.14
60 0.14
61 0.14
62 0.15
63 0.2
64 0.22
65 0.24
66 0.21
67 0.23
68 0.28
69 0.36
70 0.42
71 0.4
72 0.42
73 0.45
74 0.47
75 0.46
76 0.43
77 0.39
78 0.35
79 0.34
80 0.32
81 0.29
82 0.25
83 0.23
84 0.22
85 0.17
86 0.14
87 0.13
88 0.1
89 0.08
90 0.11
91 0.14
92 0.14