Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XQC2

Protein Details
Accession G1XQC2   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-32AKSGPGRKKKPTTPTEPTRRSBasic
69-93AVKKAKTTVTKKKPGPKPSAAKKTKHydrophilic
NLS Segment(s)
PositionSequence
15-23GPGRKKKPT
47-107TKPKAAPKKRKPAAAVKEKVVAAVKKAKTTVTKKKPGPKPSAAKKTKAADAKVTKKTKTKA
Subcellular Location(s) mito 20, nucl 7
Family & Domain DBs
Amino Acid Sequences MAPTTSSATSVAKSGPGRKKKPTTPTEPTRRSTRAVVPRTIFSSGVTKPKAAPKKRKPAAAVKEKVVAAVKKAKTTVTKKKPGPKPSAAKKTKAADAKVTKKTKTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.46
4 0.51
5 0.6
6 0.68
7 0.71
8 0.78
9 0.77
10 0.77
11 0.76
12 0.81
13 0.82
14 0.79
15 0.75
16 0.72
17 0.67
18 0.6
19 0.55
20 0.53
21 0.52
22 0.51
23 0.52
24 0.46
25 0.45
26 0.45
27 0.42
28 0.33
29 0.24
30 0.24
31 0.2
32 0.24
33 0.23
34 0.21
35 0.21
36 0.29
37 0.37
38 0.41
39 0.5
40 0.54
41 0.64
42 0.68
43 0.71
44 0.68
45 0.69
46 0.7
47 0.69
48 0.63
49 0.54
50 0.53
51 0.48
52 0.45
53 0.38
54 0.29
55 0.22
56 0.27
57 0.26
58 0.24
59 0.25
60 0.27
61 0.32
62 0.41
63 0.49
64 0.5
65 0.59
66 0.64
67 0.73
68 0.8
69 0.81
70 0.8
71 0.79
72 0.79
73 0.81
74 0.85
75 0.8
76 0.76
77 0.75
78 0.71
79 0.69
80 0.66
81 0.59
82 0.58
83 0.62
84 0.66
85 0.68
86 0.69
87 0.68