Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XAD8

Protein Details
Accession G1XAD8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-30AVNGGSKPKKVVKKKKEVVDSWDHydrophilic
135-154YDASLKKKHQEERDEQKRQEBasic
NLS Segment(s)
PositionSequence
14-23KPKKVVKKKK
Subcellular Location(s) nucl 14.5, mito_nucl 10.5, cyto 7, mito 5.5
Family & Domain DBs
Amino Acid Sequences MVDENLLAVNGGSKPKKVVKKKKEVVDSWDDEVSSGDEAASGVASDLDGPSAVSPAPPPAPPAPTPAVATPFVGDGGSSGSYYAYDPDTHSRAGSGYSDANFEGQRQAKTDAVARRMIASALGVRSRSTKEQKEYDASLKKKHQEERDEQKRQEQEREKAKAAMWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.32
3 0.42
4 0.51
5 0.6
6 0.65
7 0.75
8 0.82
9 0.86
10 0.87
11 0.81
12 0.78
13 0.76
14 0.69
15 0.61
16 0.53
17 0.43
18 0.34
19 0.3
20 0.24
21 0.15
22 0.11
23 0.07
24 0.06
25 0.06
26 0.06
27 0.05
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.07
43 0.09
44 0.09
45 0.12
46 0.14
47 0.17
48 0.18
49 0.22
50 0.22
51 0.22
52 0.23
53 0.2
54 0.22
55 0.19
56 0.18
57 0.14
58 0.11
59 0.1
60 0.09
61 0.07
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.1
75 0.12
76 0.12
77 0.12
78 0.11
79 0.11
80 0.11
81 0.1
82 0.09
83 0.09
84 0.09
85 0.1
86 0.1
87 0.11
88 0.1
89 0.1
90 0.14
91 0.15
92 0.16
93 0.17
94 0.2
95 0.19
96 0.2
97 0.26
98 0.25
99 0.25
100 0.27
101 0.25
102 0.23
103 0.23
104 0.22
105 0.16
106 0.12
107 0.11
108 0.11
109 0.13
110 0.12
111 0.12
112 0.15
113 0.18
114 0.25
115 0.31
116 0.37
117 0.42
118 0.47
119 0.52
120 0.54
121 0.55
122 0.56
123 0.57
124 0.53
125 0.55
126 0.56
127 0.59
128 0.61
129 0.65
130 0.65
131 0.65
132 0.72
133 0.75
134 0.79
135 0.81
136 0.75
137 0.76
138 0.76
139 0.71
140 0.72
141 0.7
142 0.68
143 0.69
144 0.74
145 0.69
146 0.63
147 0.6