Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1X9B7

Protein Details
Accession G1X9B7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-126LARLRSKTGKNILKRRKAKGRKMLTHBasic
NLS Segment(s)
PositionSequence
89-123PSHIVRKRRFGFLARLRSKTGKNILKRRKAKGRKM
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MTILTLLRRPAISCLRSTASSSSRRTFTSLLRTPTTIITLQTRPTLHSSPTSLIPQTTSSTSQTTSTSLLLPLQGLTQTRGHRRKTYNPSHIVRKRRFGFLARLRSKTGKNILKRRKAKGRKMLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.35
4 0.37
5 0.35
6 0.33
7 0.38
8 0.42
9 0.41
10 0.4
11 0.4
12 0.41
13 0.38
14 0.37
15 0.4
16 0.4
17 0.41
18 0.41
19 0.4
20 0.38
21 0.36
22 0.34
23 0.24
24 0.2
25 0.19
26 0.19
27 0.2
28 0.22
29 0.22
30 0.21
31 0.25
32 0.25
33 0.22
34 0.22
35 0.23
36 0.21
37 0.23
38 0.23
39 0.18
40 0.16
41 0.16
42 0.15
43 0.14
44 0.14
45 0.14
46 0.14
47 0.14
48 0.15
49 0.15
50 0.14
51 0.14
52 0.13
53 0.12
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.06
61 0.06
62 0.07
63 0.09
64 0.13
65 0.17
66 0.26
67 0.33
68 0.37
69 0.44
70 0.49
71 0.57
72 0.63
73 0.7
74 0.69
75 0.71
76 0.72
77 0.75
78 0.77
79 0.77
80 0.73
81 0.72
82 0.66
83 0.64
84 0.62
85 0.56
86 0.59
87 0.58
88 0.64
89 0.59
90 0.59
91 0.58
92 0.6
93 0.58
94 0.56
95 0.56
96 0.54
97 0.58
98 0.66
99 0.72
100 0.78
101 0.84
102 0.85
103 0.87
104 0.89
105 0.89
106 0.89