Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XT80

Protein Details
Accession G1XT80    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-134DEEAWGRKKRLQQRKERARKKKEIEDRIKAEEBasic
NLS Segment(s)
PositionSequence
108-125GRKKRLQQRKERARKKKE
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSNEEPLTPSLMLSRIQSRIADNLSGTFGTLTGTDYIRLIAIVGGYLLLRPYLEKLGAKYQERDHARAIDENEQDSMAATGQKARVIAGEGYDLDEDEDESSDEEAWGRKKRLQQRKERARKKKEIEDRIKAEEDEEDKEIQEFLQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.22
4 0.23
5 0.23
6 0.26
7 0.27
8 0.25
9 0.21
10 0.19
11 0.19
12 0.18
13 0.16
14 0.11
15 0.09
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.04
38 0.06
39 0.07
40 0.09
41 0.09
42 0.12
43 0.19
44 0.24
45 0.26
46 0.27
47 0.28
48 0.35
49 0.37
50 0.37
51 0.32
52 0.29
53 0.29
54 0.28
55 0.29
56 0.27
57 0.24
58 0.22
59 0.21
60 0.18
61 0.17
62 0.14
63 0.12
64 0.05
65 0.05
66 0.04
67 0.06
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.08
79 0.08
80 0.08
81 0.06
82 0.06
83 0.06
84 0.05
85 0.06
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.09
93 0.14
94 0.19
95 0.21
96 0.25
97 0.34
98 0.44
99 0.54
100 0.61
101 0.68
102 0.73
103 0.83
104 0.9
105 0.92
106 0.93
107 0.93
108 0.93
109 0.91
110 0.9
111 0.9
112 0.9
113 0.89
114 0.88
115 0.83
116 0.78
117 0.72
118 0.61
119 0.52
120 0.46
121 0.39
122 0.33
123 0.29
124 0.24
125 0.22
126 0.22
127 0.21