Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XGU5

Protein Details
Accession G1XGU5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-81VMINSAKKKKAKKAAAAAKKTSHydrophilic
NLS Segment(s)
PositionSequence
65-81AKKKKAKKAAAAAKKTS
Subcellular Location(s) plas 11, mito 6, cyto 5, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLIASTVFLYYTVWTLLTPFVDEDHPIQSLFPPRVWAIRIPVILLLIISAVVGSFLSVVMINSAKKKKAKKAAAAAKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.09
6 0.09
7 0.08
8 0.09
9 0.1
10 0.11
11 0.12
12 0.12
13 0.12
14 0.11
15 0.11
16 0.12
17 0.16
18 0.16
19 0.15
20 0.16
21 0.16
22 0.17
23 0.18
24 0.17
25 0.16
26 0.18
27 0.17
28 0.16
29 0.15
30 0.13
31 0.12
32 0.1
33 0.07
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.05
48 0.07
49 0.08
50 0.15
51 0.2
52 0.25
53 0.32
54 0.4
55 0.49
56 0.58
57 0.67
58 0.69
59 0.76
60 0.81
61 0.85