Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XCP7

Protein Details
Accession G1XCP7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-65IMDGLKARRGRPKRQWPNPMTRLNPHydrophilic
NLS Segment(s)
PositionSequence
46-54KARRGRPKR
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MPRKSGTVQPKRAGKKSVMSREQVLKMEKIEKIRSSAPLQIMDGLKARRGRPKRQWPNPMTRLNPYEDVPMVVKPQTTAEPQIERKSKGPLPPLKIVMESAPGTKRSKRNVTVTKFDEPEEVETDALGEASLLAHAEAGLPHHVQVPPGYSYEEFRRASKSPSEAPSDTSTPNGSYPSTPLSTHYHATPGLMSPPTFYHSPSELNSSMGVNVSSISLPPLLTSSSSAPHPWLTLPTLHYGRVEAPPWPWAPAASHSFYQNSYHSADGYHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.69
4 0.71
5 0.69
6 0.64
7 0.64
8 0.66
9 0.66
10 0.62
11 0.55
12 0.47
13 0.44
14 0.45
15 0.43
16 0.42
17 0.43
18 0.4
19 0.41
20 0.42
21 0.43
22 0.41
23 0.43
24 0.4
25 0.36
26 0.34
27 0.34
28 0.31
29 0.28
30 0.29
31 0.24
32 0.26
33 0.28
34 0.31
35 0.37
36 0.44
37 0.52
38 0.58
39 0.69
40 0.76
41 0.81
42 0.88
43 0.86
44 0.89
45 0.88
46 0.85
47 0.77
48 0.73
49 0.65
50 0.59
51 0.53
52 0.43
53 0.38
54 0.3
55 0.28
56 0.22
57 0.2
58 0.17
59 0.16
60 0.14
61 0.12
62 0.13
63 0.14
64 0.15
65 0.18
66 0.2
67 0.25
68 0.29
69 0.36
70 0.39
71 0.39
72 0.38
73 0.41
74 0.42
75 0.41
76 0.47
77 0.46
78 0.47
79 0.5
80 0.51
81 0.45
82 0.42
83 0.37
84 0.28
85 0.24
86 0.19
87 0.16
88 0.15
89 0.17
90 0.2
91 0.25
92 0.31
93 0.35
94 0.42
95 0.45
96 0.53
97 0.6
98 0.62
99 0.64
100 0.62
101 0.59
102 0.52
103 0.47
104 0.39
105 0.3
106 0.27
107 0.22
108 0.18
109 0.13
110 0.11
111 0.11
112 0.09
113 0.08
114 0.05
115 0.03
116 0.02
117 0.02
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.03
125 0.03
126 0.05
127 0.05
128 0.05
129 0.08
130 0.08
131 0.08
132 0.09
133 0.11
134 0.1
135 0.11
136 0.12
137 0.1
138 0.13
139 0.16
140 0.22
141 0.21
142 0.21
143 0.24
144 0.24
145 0.27
146 0.29
147 0.29
148 0.28
149 0.3
150 0.35
151 0.31
152 0.33
153 0.34
154 0.32
155 0.29
156 0.25
157 0.22
158 0.17
159 0.17
160 0.15
161 0.13
162 0.11
163 0.12
164 0.15
165 0.15
166 0.15
167 0.17
168 0.21
169 0.23
170 0.24
171 0.23
172 0.22
173 0.2
174 0.2
175 0.18
176 0.13
177 0.13
178 0.13
179 0.13
180 0.12
181 0.13
182 0.15
183 0.15
184 0.15
185 0.16
186 0.17
187 0.2
188 0.2
189 0.25
190 0.22
191 0.23
192 0.22
193 0.19
194 0.17
195 0.15
196 0.14
197 0.08
198 0.07
199 0.07
200 0.07
201 0.06
202 0.07
203 0.07
204 0.07
205 0.07
206 0.08
207 0.08
208 0.09
209 0.11
210 0.11
211 0.13
212 0.15
213 0.16
214 0.16
215 0.17
216 0.17
217 0.16
218 0.17
219 0.17
220 0.19
221 0.2
222 0.25
223 0.26
224 0.26
225 0.26
226 0.24
227 0.25
228 0.27
229 0.26
230 0.21
231 0.2
232 0.25
233 0.25
234 0.26
235 0.23
236 0.2
237 0.22
238 0.25
239 0.29
240 0.28
241 0.29
242 0.29
243 0.31
244 0.31
245 0.32
246 0.28
247 0.26
248 0.25
249 0.24
250 0.21