Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XDQ8

Protein Details
Accession G1XDQ8    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
5-47ILGGNGKKPKQDRHVRPRENPPERKKDREPKPKQEIPNREPRKBasic
NLS Segment(s)
PositionSequence
10-49GKKPKQDRHVRPRENPPERKKDREPKPKQEIPNREPRKER
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MFKGILGGNGKKPKQDRHVRPRENPPERKKDREPKPKQEIPNREPRKERPAQNSANNIPNCKIDILKFPLFPLKWPTPEMSHQEWYSSVSLGKDDAEFIIAWWWQKVQLFFRVHDPHTLQVEEDLREAVKNVKRLRRERDAWKKEHDDVFVMYQKLKMASDKRKLERKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.71
4 0.73
5 0.83
6 0.85
7 0.88
8 0.9
9 0.9
10 0.9
11 0.89
12 0.88
13 0.87
14 0.85
15 0.85
16 0.85
17 0.84
18 0.84
19 0.85
20 0.86
21 0.85
22 0.88
23 0.88
24 0.87
25 0.87
26 0.86
27 0.81
28 0.82
29 0.79
30 0.75
31 0.73
32 0.7
33 0.69
34 0.67
35 0.69
36 0.66
37 0.68
38 0.68
39 0.69
40 0.7
41 0.64
42 0.64
43 0.57
44 0.5
45 0.42
46 0.36
47 0.3
48 0.23
49 0.21
50 0.14
51 0.19
52 0.24
53 0.25
54 0.24
55 0.23
56 0.28
57 0.27
58 0.27
59 0.28
60 0.25
61 0.24
62 0.26
63 0.27
64 0.24
65 0.28
66 0.32
67 0.29
68 0.29
69 0.27
70 0.26
71 0.25
72 0.23
73 0.2
74 0.15
75 0.11
76 0.08
77 0.08
78 0.08
79 0.08
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.08
92 0.1
93 0.12
94 0.13
95 0.21
96 0.23
97 0.24
98 0.32
99 0.35
100 0.34
101 0.37
102 0.36
103 0.31
104 0.32
105 0.31
106 0.23
107 0.22
108 0.23
109 0.19
110 0.18
111 0.15
112 0.12
113 0.12
114 0.13
115 0.17
116 0.18
117 0.25
118 0.32
119 0.38
120 0.48
121 0.56
122 0.63
123 0.66
124 0.69
125 0.73
126 0.77
127 0.79
128 0.76
129 0.77
130 0.75
131 0.72
132 0.69
133 0.59
134 0.51
135 0.44
136 0.44
137 0.41
138 0.35
139 0.3
140 0.26
141 0.26
142 0.26
143 0.24
144 0.26
145 0.3
146 0.39
147 0.49
148 0.57
149 0.64