Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XB92

Protein Details
Accession G1XB92   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
306-331KEGAYGKKVKRDIERKKIRRAANAETBasic
NLS Segment(s)
PositionSequence
311-325GKKVKRDIERKKIRR
Subcellular Location(s) cyto 9extr 9, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021476  Egh16-like  
Pfam View protein in Pfam  
PF11327  Egh16-like  
Amino Acid Sequences MVGFKISAGLALSILINTGEVSAHARLYNNYGDYDQSKLGGSLAHAYDIPVIDHGDHQHPGQWDVKVFSDPVIPATWESPFKHIPRKYMPQGCGADLHFIFAYNMAHRRGEINPANLQNDHVTLWKHRNYHFFMAPIPQGALVNTKQQIDYNAKHGRIAQVTPGGWLDIRSYQVNADGAGPFKCRLDETSTGQHFSTQLPILKEVPGGPGSVNWHSAKKAYIMRVGIPKDIKCLARYGTYNNVCLMRCENQAHNGPFGACIPFQVMYPKPPAAPPKPVYIDVKKPEPEPKPVYGYAGYDVGKGNYKEGAYGKKVKRDIERKKIRRAANAETDTQSEDTEVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.06
6 0.05
7 0.05
8 0.09
9 0.1
10 0.11
11 0.13
12 0.14
13 0.15
14 0.19
15 0.23
16 0.21
17 0.22
18 0.21
19 0.23
20 0.23
21 0.25
22 0.22
23 0.18
24 0.17
25 0.16
26 0.15
27 0.13
28 0.13
29 0.15
30 0.14
31 0.14
32 0.14
33 0.14
34 0.16
35 0.15
36 0.14
37 0.1
38 0.1
39 0.1
40 0.12
41 0.14
42 0.16
43 0.17
44 0.17
45 0.2
46 0.21
47 0.23
48 0.25
49 0.24
50 0.22
51 0.23
52 0.25
53 0.22
54 0.21
55 0.18
56 0.17
57 0.16
58 0.15
59 0.14
60 0.13
61 0.13
62 0.14
63 0.16
64 0.17
65 0.18
66 0.22
67 0.26
68 0.3
69 0.39
70 0.4
71 0.45
72 0.49
73 0.57
74 0.62
75 0.64
76 0.62
77 0.61
78 0.6
79 0.54
80 0.48
81 0.39
82 0.35
83 0.26
84 0.26
85 0.17
86 0.15
87 0.14
88 0.13
89 0.13
90 0.11
91 0.14
92 0.14
93 0.15
94 0.15
95 0.17
96 0.17
97 0.25
98 0.26
99 0.26
100 0.3
101 0.32
102 0.34
103 0.31
104 0.32
105 0.24
106 0.21
107 0.18
108 0.15
109 0.13
110 0.15
111 0.22
112 0.25
113 0.28
114 0.31
115 0.37
116 0.4
117 0.44
118 0.42
119 0.36
120 0.33
121 0.32
122 0.29
123 0.23
124 0.17
125 0.12
126 0.11
127 0.1
128 0.12
129 0.1
130 0.13
131 0.14
132 0.15
133 0.15
134 0.15
135 0.19
136 0.21
137 0.22
138 0.26
139 0.29
140 0.29
141 0.29
142 0.3
143 0.29
144 0.25
145 0.24
146 0.18
147 0.16
148 0.16
149 0.16
150 0.15
151 0.12
152 0.1
153 0.1
154 0.09
155 0.07
156 0.09
157 0.09
158 0.09
159 0.09
160 0.1
161 0.1
162 0.09
163 0.09
164 0.07
165 0.08
166 0.09
167 0.1
168 0.09
169 0.09
170 0.09
171 0.09
172 0.1
173 0.15
174 0.18
175 0.21
176 0.29
177 0.3
178 0.31
179 0.3
180 0.29
181 0.24
182 0.21
183 0.2
184 0.13
185 0.15
186 0.15
187 0.17
188 0.17
189 0.17
190 0.17
191 0.14
192 0.14
193 0.11
194 0.11
195 0.09
196 0.09
197 0.12
198 0.13
199 0.16
200 0.16
201 0.17
202 0.17
203 0.18
204 0.17
205 0.19
206 0.22
207 0.21
208 0.25
209 0.24
210 0.27
211 0.33
212 0.33
213 0.32
214 0.31
215 0.29
216 0.28
217 0.31
218 0.29
219 0.23
220 0.24
221 0.22
222 0.23
223 0.24
224 0.25
225 0.31
226 0.32
227 0.32
228 0.31
229 0.33
230 0.28
231 0.28
232 0.28
233 0.22
234 0.24
235 0.26
236 0.26
237 0.29
238 0.36
239 0.36
240 0.34
241 0.31
242 0.27
243 0.24
244 0.23
245 0.2
246 0.12
247 0.11
248 0.12
249 0.11
250 0.11
251 0.16
252 0.16
253 0.17
254 0.22
255 0.23
256 0.22
257 0.26
258 0.35
259 0.34
260 0.42
261 0.41
262 0.45
263 0.48
264 0.51
265 0.53
266 0.51
267 0.56
268 0.52
269 0.57
270 0.51
271 0.51
272 0.56
273 0.53
274 0.56
275 0.52
276 0.52
277 0.5
278 0.48
279 0.49
280 0.41
281 0.39
282 0.32
283 0.3
284 0.26
285 0.21
286 0.21
287 0.19
288 0.23
289 0.22
290 0.21
291 0.2
292 0.2
293 0.22
294 0.26
295 0.31
296 0.32
297 0.42
298 0.46
299 0.51
300 0.56
301 0.59
302 0.65
303 0.69
304 0.73
305 0.75
306 0.81
307 0.8
308 0.87
309 0.89
310 0.85
311 0.84
312 0.8
313 0.78
314 0.77
315 0.73
316 0.67
317 0.6
318 0.55
319 0.48
320 0.42
321 0.33
322 0.24