Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XKB8

Protein Details
Accession G1XKB8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
130-149STAEKKERRQGIKKADTDKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8.5, cyto_mito 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010686  OBAP-like  
Pfam View protein in Pfam  
PF06884  DUF1264  
Amino Acid Sequences MRQCLIFDSHEQGARLIGIEYLITEKIFSTLPESEKKLWHTHNYEVKSGILAMPQPSISPIPAAAWDVLEDAEMKELIKMYGKTYHLWQVDKHDVPMGEPQLMSTYTKEDQVPSGLRTALEKRDKELGISTAEKKERRQGIKKADTDKCDEVDQAWKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.14
4 0.1
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.08
11 0.07
12 0.07
13 0.08
14 0.09
15 0.09
16 0.11
17 0.15
18 0.18
19 0.23
20 0.27
21 0.29
22 0.32
23 0.36
24 0.38
25 0.39
26 0.44
27 0.44
28 0.48
29 0.53
30 0.52
31 0.5
32 0.45
33 0.4
34 0.32
35 0.28
36 0.2
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.08
47 0.07
48 0.07
49 0.07
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.07
66 0.07
67 0.08
68 0.14
69 0.15
70 0.16
71 0.17
72 0.24
73 0.24
74 0.25
75 0.24
76 0.26
77 0.31
78 0.31
79 0.3
80 0.25
81 0.23
82 0.23
83 0.26
84 0.2
85 0.14
86 0.13
87 0.13
88 0.12
89 0.13
90 0.13
91 0.1
92 0.12
93 0.12
94 0.15
95 0.15
96 0.14
97 0.15
98 0.18
99 0.19
100 0.16
101 0.18
102 0.16
103 0.16
104 0.18
105 0.21
106 0.26
107 0.31
108 0.31
109 0.32
110 0.39
111 0.39
112 0.37
113 0.36
114 0.3
115 0.26
116 0.3
117 0.3
118 0.31
119 0.37
120 0.38
121 0.39
122 0.46
123 0.5
124 0.56
125 0.61
126 0.64
127 0.69
128 0.75
129 0.79
130 0.8
131 0.78
132 0.73
133 0.71
134 0.65
135 0.57
136 0.49
137 0.42
138 0.35
139 0.37