Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H574

Protein Details
Accession Q2H574    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
221-245GAAGRSRRVWPWQKRTDGRRVKEDYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MSRTPVALILIAGSLVLLWFVILSGVTHTSPLRQTYFLRADTSGIEGARSISQWTFFKVCGDGNTDCGPSRPGLPLGDAWASNARNAPSELIGSHGNDTTSYFYWYMWRFGWVFFLIALFFEVLAFFSGFLALCSRLGSMFTGLISLVALFFLTLAVSLMTATFVKMRDVFIREGRDASLGRYAFGFSWGAWALLLISTILFCLARNKRKDTAATVAPAPGAAGRSRRVWPWQKRTDGRRVKEDYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.04
11 0.06
12 0.08
13 0.08
14 0.1
15 0.11
16 0.14
17 0.17
18 0.21
19 0.21
20 0.22
21 0.24
22 0.31
23 0.37
24 0.35
25 0.35
26 0.32
27 0.3
28 0.28
29 0.29
30 0.22
31 0.16
32 0.14
33 0.12
34 0.13
35 0.12
36 0.12
37 0.11
38 0.09
39 0.13
40 0.14
41 0.18
42 0.18
43 0.18
44 0.19
45 0.19
46 0.19
47 0.17
48 0.21
49 0.18
50 0.2
51 0.22
52 0.21
53 0.2
54 0.19
55 0.19
56 0.14
57 0.16
58 0.14
59 0.14
60 0.14
61 0.15
62 0.15
63 0.16
64 0.16
65 0.14
66 0.14
67 0.17
68 0.16
69 0.16
70 0.17
71 0.15
72 0.15
73 0.16
74 0.15
75 0.11
76 0.11
77 0.1
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.1
84 0.1
85 0.1
86 0.11
87 0.1
88 0.12
89 0.11
90 0.11
91 0.15
92 0.16
93 0.17
94 0.15
95 0.16
96 0.15
97 0.15
98 0.17
99 0.13
100 0.12
101 0.09
102 0.09
103 0.07
104 0.06
105 0.07
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.04
112 0.04
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.05
150 0.06
151 0.07
152 0.08
153 0.09
154 0.11
155 0.14
156 0.17
157 0.2
158 0.23
159 0.27
160 0.26
161 0.26
162 0.25
163 0.24
164 0.21
165 0.2
166 0.22
167 0.17
168 0.17
169 0.16
170 0.16
171 0.14
172 0.15
173 0.14
174 0.08
175 0.11
176 0.11
177 0.11
178 0.1
179 0.09
180 0.08
181 0.07
182 0.08
183 0.04
184 0.04
185 0.04
186 0.04
187 0.05
188 0.04
189 0.05
190 0.14
191 0.23
192 0.31
193 0.37
194 0.43
195 0.48
196 0.53
197 0.57
198 0.53
199 0.52
200 0.49
201 0.46
202 0.41
203 0.37
204 0.32
205 0.27
206 0.22
207 0.15
208 0.12
209 0.12
210 0.15
211 0.17
212 0.21
213 0.24
214 0.28
215 0.37
216 0.46
217 0.54
218 0.61
219 0.68
220 0.74
221 0.81
222 0.85
223 0.86
224 0.86
225 0.82
226 0.81