Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XJU5

Protein Details
Accession G1XJU5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-134VAKLVRSMTKKHKEKKEQQQNNGADGHydrophilic
NLS Segment(s)
PositionSequence
119-119K
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MCRYRKYIYVNCGHSEFESPPYLPCVSDPNEYCSPETTSDPPITLKKNTACNDPACAGPGGAPLSPTGPADGGTSWSRTNSGNRGRALGPGEGDPGDRLRHTVSTKMKVAKLVRSMTKKHKEKKEQQQNNGADGFLPDNHGSYNEINEMDELKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.31
4 0.26
5 0.25
6 0.22
7 0.21
8 0.23
9 0.23
10 0.19
11 0.19
12 0.2
13 0.21
14 0.27
15 0.28
16 0.31
17 0.35
18 0.36
19 0.36
20 0.33
21 0.32
22 0.27
23 0.29
24 0.25
25 0.24
26 0.23
27 0.23
28 0.24
29 0.25
30 0.27
31 0.25
32 0.28
33 0.29
34 0.37
35 0.38
36 0.41
37 0.4
38 0.38
39 0.39
40 0.34
41 0.3
42 0.23
43 0.21
44 0.15
45 0.12
46 0.12
47 0.1
48 0.09
49 0.09
50 0.07
51 0.08
52 0.08
53 0.08
54 0.07
55 0.06
56 0.06
57 0.07
58 0.07
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.12
66 0.14
67 0.19
68 0.25
69 0.29
70 0.29
71 0.32
72 0.31
73 0.32
74 0.32
75 0.25
76 0.19
77 0.14
78 0.14
79 0.12
80 0.12
81 0.1
82 0.09
83 0.1
84 0.09
85 0.09
86 0.1
87 0.14
88 0.15
89 0.22
90 0.27
91 0.32
92 0.37
93 0.4
94 0.4
95 0.42
96 0.44
97 0.42
98 0.42
99 0.42
100 0.45
101 0.46
102 0.51
103 0.56
104 0.63
105 0.67
106 0.7
107 0.75
108 0.79
109 0.84
110 0.89
111 0.9
112 0.89
113 0.88
114 0.89
115 0.81
116 0.74
117 0.64
118 0.52
119 0.41
120 0.32
121 0.26
122 0.16
123 0.17
124 0.13
125 0.13
126 0.14
127 0.15
128 0.16
129 0.15
130 0.18
131 0.16
132 0.17
133 0.17
134 0.17