Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XHH0

Protein Details
Accession G1XHH0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-76AVTRDWKYKLAKKKANRRGGPVGEHydrophilic
NLS Segment(s)
PositionSequence
40-72KKERVKKLIEKSEAVTRDWKYKLAKKKANRRGG
Subcellular Location(s) nucl 17, mito_nucl 12.499, cyto_nucl 11.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MVISSDSCRSQSTNTKDCWEKLYRAVIRSAQVPGKTSLEKKERVKKLIEKSEAVTRDWKYKLAKKKANRRGGPVGEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.5
4 0.5
5 0.51
6 0.45
7 0.4
8 0.37
9 0.44
10 0.41
11 0.39
12 0.4
13 0.36
14 0.33
15 0.32
16 0.3
17 0.24
18 0.22
19 0.22
20 0.21
21 0.21
22 0.22
23 0.22
24 0.26
25 0.27
26 0.33
27 0.39
28 0.46
29 0.5
30 0.51
31 0.55
32 0.56
33 0.61
34 0.64
35 0.6
36 0.52
37 0.49
38 0.53
39 0.49
40 0.42
41 0.39
42 0.31
43 0.34
44 0.34
45 0.36
46 0.36
47 0.43
48 0.52
49 0.57
50 0.64
51 0.68
52 0.78
53 0.83
54 0.87
55 0.84
56 0.82
57 0.82