Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XIX0

Protein Details
Accession G1XIX0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
112-132DLERLKKIRCHRGLRHYWGLRBasic
NLS Segment(s)
PositionSequence
141-156TGRRGRTVGVSKKKGG
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027437  30s_Rbsml_prot_S13_C  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
IPR018269  Ribosomal_S13_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS00646  RIBOSOMAL_S13_1  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MSLVNPEKSNFQYILRLLNTNVDGKQKVMYAMTKIGGVGRRYSNLVCKKADIDLTKRAGELTTEELERIITIIQDPTAYKIPSWFLNRQRDIVDGKNSQILANGLQSKLRDDLERLKKIRCHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.31
4 0.27
5 0.3
6 0.3
7 0.27
8 0.28
9 0.26
10 0.24
11 0.24
12 0.25
13 0.21
14 0.2
15 0.2
16 0.2
17 0.18
18 0.19
19 0.19
20 0.17
21 0.16
22 0.18
23 0.2
24 0.19
25 0.21
26 0.2
27 0.21
28 0.23
29 0.24
30 0.3
31 0.33
32 0.36
33 0.33
34 0.33
35 0.32
36 0.32
37 0.36
38 0.31
39 0.28
40 0.31
41 0.33
42 0.32
43 0.3
44 0.28
45 0.23
46 0.2
47 0.17
48 0.14
49 0.12
50 0.12
51 0.12
52 0.12
53 0.11
54 0.11
55 0.09
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.1
65 0.1
66 0.1
67 0.1
68 0.12
69 0.16
70 0.21
71 0.25
72 0.3
73 0.39
74 0.41
75 0.41
76 0.41
77 0.39
78 0.37
79 0.34
80 0.32
81 0.24
82 0.24
83 0.25
84 0.24
85 0.21
86 0.19
87 0.16
88 0.11
89 0.14
90 0.15
91 0.13
92 0.14
93 0.14
94 0.15
95 0.17
96 0.17
97 0.14
98 0.16
99 0.26
100 0.34
101 0.42
102 0.42
103 0.45
104 0.5
105 0.57
106 0.65
107 0.64
108 0.64
109 0.65
110 0.73
111 0.78
112 0.8
113 0.82
114 0.75
115 0.72
116 0.69
117 0.64
118 0.57
119 0.54
120 0.51
121 0.5
122 0.49
123 0.49
124 0.49
125 0.55
126 0.57
127 0.62
128 0.64
129 0.6
130 0.63
131 0.61
132 0.61
133 0.6
134 0.64
135 0.63
136 0.67