Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XS86

Protein Details
Accession G1XS86    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
157-178LAPRKRSKVSRACDECRRKKVFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MAEVALAPSSQLVTHRSNPTKYLTITLPLRRSIYSPPSSATFPTDSHWSSKEYSRTDSDLIPKPRYLGTSYTTYSPPRTSVVDRFGREDQDRGRQNNVSPSMLLSSPSSSFITRGLPPIISPMDAPMQGYDQRPSSPRTVPSGYADASMEMGGPSDLAPRKRSKVSRACDECRRKKVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.35
3 0.41
4 0.43
5 0.45
6 0.49
7 0.49
8 0.45
9 0.42
10 0.34
11 0.35
12 0.39
13 0.43
14 0.41
15 0.39
16 0.4
17 0.36
18 0.37
19 0.36
20 0.38
21 0.35
22 0.33
23 0.32
24 0.33
25 0.33
26 0.32
27 0.29
28 0.23
29 0.2
30 0.21
31 0.24
32 0.23
33 0.24
34 0.24
35 0.23
36 0.23
37 0.28
38 0.32
39 0.3
40 0.32
41 0.33
42 0.34
43 0.33
44 0.33
45 0.35
46 0.36
47 0.38
48 0.37
49 0.34
50 0.33
51 0.32
52 0.31
53 0.27
54 0.21
55 0.19
56 0.21
57 0.22
58 0.22
59 0.23
60 0.23
61 0.23
62 0.21
63 0.19
64 0.17
65 0.19
66 0.2
67 0.21
68 0.27
69 0.31
70 0.3
71 0.33
72 0.32
73 0.33
74 0.31
75 0.3
76 0.25
77 0.27
78 0.31
79 0.29
80 0.31
81 0.29
82 0.3
83 0.34
84 0.34
85 0.26
86 0.21
87 0.2
88 0.19
89 0.17
90 0.17
91 0.11
92 0.1
93 0.1
94 0.12
95 0.13
96 0.11
97 0.12
98 0.12
99 0.14
100 0.13
101 0.15
102 0.14
103 0.13
104 0.13
105 0.16
106 0.15
107 0.13
108 0.12
109 0.11
110 0.12
111 0.12
112 0.13
113 0.1
114 0.12
115 0.14
116 0.16
117 0.16
118 0.16
119 0.18
120 0.2
121 0.23
122 0.25
123 0.27
124 0.28
125 0.32
126 0.34
127 0.34
128 0.36
129 0.36
130 0.32
131 0.29
132 0.26
133 0.2
134 0.18
135 0.15
136 0.11
137 0.07
138 0.07
139 0.05
140 0.05
141 0.05
142 0.11
143 0.16
144 0.19
145 0.24
146 0.3
147 0.36
148 0.45
149 0.51
150 0.56
151 0.61
152 0.66
153 0.72
154 0.75
155 0.77
156 0.79
157 0.84
158 0.83