Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1WZ18

Protein Details
Accession G1WZ18    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
115-149EEKKEEKKEEEKKEEKKEDKKEDKKEAKEEKKEEKAcidic
158-179TEEPKEEKKKEEPKAEEKKSEKAcidic
NLS Segment(s)
PositionSequence
96-179PPPKEEEKPAAKPVEPEVKEEKKEEKKEEEKKEEKKEDKKEDKKEAKEEKKEEKTEEKKEEKTEEPKEEKKKEEPKAEEKKSEK
Subcellular Location(s) mito 16.5, cyto_mito 12, cyto 4.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MFRPASRRLVTVASRSGLAARGVNRIVARRGYSDAHHAYEKTSDTPWLLAAVGFTVPASYWLIKAAPAPHKGGHDDHHDSHAAPKEAKVESHTPPPPPKEEEKPAAKPVEPEVKEEKKEEKKEEEKKEEKKEDKKEDKKEAKEEKKEEKTEEKKEEKTEEPKEEKKKEEPKAEEKKSEKSDDEKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.24
5 0.22
6 0.2
7 0.17
8 0.21
9 0.21
10 0.23
11 0.24
12 0.25
13 0.27
14 0.27
15 0.27
16 0.25
17 0.28
18 0.27
19 0.27
20 0.32
21 0.32
22 0.31
23 0.31
24 0.29
25 0.27
26 0.28
27 0.28
28 0.21
29 0.19
30 0.17
31 0.16
32 0.16
33 0.15
34 0.13
35 0.11
36 0.09
37 0.08
38 0.07
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.11
52 0.15
53 0.19
54 0.22
55 0.24
56 0.25
57 0.26
58 0.28
59 0.28
60 0.25
61 0.26
62 0.29
63 0.27
64 0.28
65 0.27
66 0.24
67 0.27
68 0.28
69 0.23
70 0.18
71 0.18
72 0.2
73 0.19
74 0.19
75 0.19
76 0.18
77 0.19
78 0.26
79 0.27
80 0.27
81 0.31
82 0.33
83 0.33
84 0.33
85 0.35
86 0.34
87 0.37
88 0.4
89 0.43
90 0.44
91 0.45
92 0.43
93 0.39
94 0.34
95 0.33
96 0.36
97 0.3
98 0.31
99 0.34
100 0.37
101 0.38
102 0.4
103 0.44
104 0.44
105 0.49
106 0.5
107 0.51
108 0.56
109 0.64
110 0.71
111 0.72
112 0.72
113 0.75
114 0.8
115 0.8
116 0.79
117 0.79
118 0.8
119 0.81
120 0.83
121 0.84
122 0.83
123 0.85
124 0.85
125 0.83
126 0.83
127 0.83
128 0.82
129 0.82
130 0.8
131 0.8
132 0.8
133 0.77
134 0.72
135 0.72
136 0.71
137 0.71
138 0.73
139 0.69
140 0.65
141 0.67
142 0.67
143 0.64
144 0.64
145 0.63
146 0.63
147 0.64
148 0.68
149 0.72
150 0.73
151 0.72
152 0.73
153 0.74
154 0.74
155 0.76
156 0.76
157 0.76
158 0.81
159 0.82
160 0.82
161 0.77
162 0.77
163 0.74
164 0.72
165 0.66
166 0.62