Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XKP0

Protein Details
Accession G1XKP0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-46KQEFEEKQKRKEEKNKDKDKDKDKKEKEKEKEKAKVKDBasic
NLS Segment(s)
PositionSequence
15-45KQKRKEEKNKDKDKDKDKKEKEKEKEKAKVK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MGKELEKLKQEFEEKQKRKEEKNKDKDKDKDKKEKEKEKEKAKVKDEETDKLKVEETEKAKTEQAVEASSFSEYNLHRCTFERLHDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.69
4 0.7
5 0.76
6 0.78
7 0.79
8 0.79
9 0.85
10 0.87
11 0.85
12 0.88
13 0.87
14 0.87
15 0.86
16 0.84
17 0.84
18 0.82
19 0.85
20 0.86
21 0.87
22 0.86
23 0.86
24 0.85
25 0.84
26 0.84
27 0.81
28 0.79
29 0.73
30 0.71
31 0.62
32 0.61
33 0.54
34 0.51
35 0.46
36 0.41
37 0.37
38 0.31
39 0.3
40 0.24
41 0.23
42 0.23
43 0.23
44 0.25
45 0.26
46 0.27
47 0.27
48 0.27
49 0.27
50 0.23
51 0.21
52 0.18
53 0.17
54 0.15
55 0.15
56 0.15
57 0.13
58 0.11
59 0.14
60 0.13
61 0.18
62 0.22
63 0.22
64 0.23
65 0.25
66 0.33
67 0.32