Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XGV8

Protein Details
Accession G1XGV8    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
185-208APKLTDFGRRARRARKNVGNVTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSTASLRPILRSTTTSLKSRSIPSFTLTKTQHRTATEIRRPDRRYQFEQIVILSDGSSYKQLTSSPQGVFRSNKDVRNHILWNPTSESLANVEEDEAGRLRKFREKFGTGFDASRAIAEEAGDKDAIKHMDKHWQDGGMMEEGDVEVWKNEIERKKVEAEAPEQPPQEQAPEENLFGLISGTYAAPKLTDFGRRARRARKNVGNVTPSEGGRPDDDGKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.43
4 0.43
5 0.45
6 0.49
7 0.49
8 0.44
9 0.41
10 0.38
11 0.42
12 0.39
13 0.44
14 0.41
15 0.45
16 0.46
17 0.5
18 0.53
19 0.48
20 0.52
21 0.52
22 0.59
23 0.58
24 0.61
25 0.61
26 0.65
27 0.68
28 0.72
29 0.73
30 0.7
31 0.69
32 0.67
33 0.68
34 0.62
35 0.59
36 0.49
37 0.41
38 0.34
39 0.27
40 0.19
41 0.13
42 0.1
43 0.09
44 0.1
45 0.08
46 0.08
47 0.08
48 0.09
49 0.13
50 0.18
51 0.22
52 0.22
53 0.27
54 0.29
55 0.32
56 0.33
57 0.32
58 0.36
59 0.36
60 0.41
61 0.39
62 0.41
63 0.4
64 0.43
65 0.44
66 0.37
67 0.4
68 0.34
69 0.34
70 0.32
71 0.29
72 0.24
73 0.22
74 0.19
75 0.14
76 0.14
77 0.11
78 0.08
79 0.08
80 0.07
81 0.07
82 0.08
83 0.06
84 0.07
85 0.07
86 0.08
87 0.09
88 0.16
89 0.18
90 0.23
91 0.29
92 0.31
93 0.32
94 0.36
95 0.39
96 0.33
97 0.32
98 0.26
99 0.2
100 0.17
101 0.16
102 0.12
103 0.07
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.07
111 0.07
112 0.09
113 0.11
114 0.11
115 0.12
116 0.13
117 0.22
118 0.23
119 0.26
120 0.25
121 0.24
122 0.23
123 0.22
124 0.22
125 0.14
126 0.14
127 0.1
128 0.08
129 0.07
130 0.07
131 0.06
132 0.04
133 0.03
134 0.04
135 0.04
136 0.05
137 0.11
138 0.16
139 0.2
140 0.23
141 0.26
142 0.29
143 0.31
144 0.34
145 0.32
146 0.31
147 0.35
148 0.37
149 0.38
150 0.36
151 0.33
152 0.32
153 0.29
154 0.27
155 0.2
156 0.17
157 0.18
158 0.2
159 0.2
160 0.18
161 0.18
162 0.15
163 0.14
164 0.13
165 0.06
166 0.04
167 0.05
168 0.05
169 0.05
170 0.06
171 0.06
172 0.06
173 0.06
174 0.08
175 0.1
176 0.17
177 0.19
178 0.28
179 0.39
180 0.47
181 0.55
182 0.64
183 0.72
184 0.74
185 0.82
186 0.83
187 0.83
188 0.85
189 0.85
190 0.8
191 0.71
192 0.67
193 0.61
194 0.51
195 0.43
196 0.35
197 0.29
198 0.25
199 0.29